KEGG   Escherichia coli K-12 W3110: JW2147Help
Entry
JW2147            CDS       T00068                                 

Gene name
yeiI
Definition
(GenBank) predicted kinase
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2255034..2256122
Genome map
AA seq 362 aa AA seqDB search
MNNREKEILAILRRNPLIQQNEIADMLQISRSRVAAHIMDLMRKGRIKGKGYILTEQEYC
VVVGTINMDIRGMADIRYPQSASHPGTIHCSAGGVGRNIAHNLALLGRDVHLLSVIGDDF
YGEMLLEETRRAGVNVSGCVRLHGQSTSTYLAIANRDDQTVLAINDTHLLEQLTPQLLNG
SRDLLRHAGVVLADCNLTAEALEWVFTLADEIPVFVDTVSEFKAGKIKHWLAHIHTLKPT
LPELEILWGQAITSDADRNTAVNALHQQGVQQLFVYLPDESVYCSEKDGEQFLLTAPAHT
TVDSFGADDGFMAGLVYSFLEGYSFRDSARFAVACAAISRASGSLNNPTLSADNALSLVP
MV
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaataaccgggaaaaggagatccttgcaattttacggcgtaacccgctgattcagcag
aacgaaattgcggacatgctgcaaatcagccgttcgcgcgttgcggcgcatattatggat
ttaatgcgcaaaggccggattaaaggcaaaggttacattctcaccgagcaggaatactgc
gtagtggtggggacaatcaatatggatattcgcgggatggcggatatccgttacccgcaa
tcggcttctcatcccggtacaattcattgctcagcgggcggcgtgggacgcaacatcgcc
cacaatctggcgctgttaggccgtgacgtccatttgctttcagtgattggcgatgacttt
tatggcgaaatgctcctggaagaaacgcgccgtgccggcgtgaatgtctccggctgcgtt
cgtttgcatggtcaaagcacatcgacgtatctggcaattgccaatcgagacgatcaaacc
gtgctggcgattaacgatacccatctgctggaacagttgacaccgcaactactgaacggg
tcgcgcgatttacttcgtcatgcgggcgtggtactggctgattgcaacctgacagccgag
gcgctggaatgggtctttaccctcgctgatgaaatcccggtgtttgtcgataccgtttca
gaattcaaagcgggcaaaatcaaacactggctggcgcatattcacaccctgaaacccact
ttaccggagctggaaattttatggggacaggcgatcaccagcgatgctgaccgtaatacc
gcagtgaatgcattgcatcagcaaggtgttcagcaactgtttgtttatttgcccgatgag
tcagtttattgcagcgaaaaggatggagaacaatttttgctgaccgcgccagcgcatacg
acagtagacagttttggtgctgacgatggttttatggcgggcctggtatatagctttctt
gaaggatacagtttccgcgacagcgcccgttttgcggtagcctgcgcggcaatttcgcgc
gccagcggcagcttaaacaaccctaccctgtctgccgataacgcgctttcattagtgcca
atggtgtaa

DBGET integrated database retrieval system