KEGG   Escherichia coli K-12 W3110: JW2406Help
Entry
JW2406            CDS       T00068                                 

Gene name
cysZ
Definition
(GenBank) predicted inner membrane protein
  KO
K06203  
CysZ protein
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2536909..2537670
Genome map
AA seq 253 aa AA seqDB search
MVSSFTSAPRSGFYYFAQGWKLVSQPGIRRFVILPLLVNILLMGGAFWWLFTQLDVWIPT
LMSYVPDWLQWLSYLLWPLAVISVLLVFGYFFSTIANWIAAPFNGLLAEQLEARLTGATP
PDTGIFGIMKDVPRIMKREWQKFAWYLPRAIVLLILYFIPGIGQTVAPVLWFLFSAWMLA
IQYCDYPFDNHKVPFKEMRTALRTRKITNMQFGALTSLFTMIPLLNLFIMPVAVCGATAM
WVDCYRDKHAMWR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggtttcatcattcacatctgccccacgcagcggtttttactattttgcgcaaggctgg
aagctcgtctcgcaacctgggattcggcgtttcgttattttaccgctgctggtcaatatt
ttgttgatggggggcgcattctggtggctctttacacagctcgatgtctggatcccgact
ctcatgagttacgttccggactggctacaatggctgagttatctgttgtggcctctggct
gtcatctctgtgctgttagtgtttggctatttcttctccacgattgctaactggattgcc
gctccgtttaacggtttattggctgaacaactggaagcacgattgactggcgctacaccg
ccagataccgggattttcggtatcatgaaagatgtgccgcgaatcatgaaacgcgaatgg
caaaaatttgcctggtatctgccgcgcgcaattgtattactaattctttacttcatccct
ggtattgggcaaaccgtcgcgccggtactgtggttcctgtttagcgcctggatgttagcc
atccagtattgcgattaccccttcgataaccacaaagtgccgtttaaagagatgcgcacc
gccctgcgcacacgcaaaatcaccaatatgcagtttggtgctttaaccagcctgtttacg
atgatcccgctgcttaatctgttcatcatgcccgttgccgtttgtggcgcgacggcgatg
tgggtcgattgctatcgcgataaacacgcgatgtggcggtaa

DBGET integrated database retrieval system