KEGG   Escherichia coli K-12 W3110: JW2447Help
Entry
JW2447            CDS       T00068                                 

Gene name
maeB
Definition
(GenBank) fused malic enzyme predicted oxidoreductase and predicted phosphotransacetylase
  KO
K00029  
malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
Pyruvate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ecj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    JW2447 (maeB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    JW2447 (maeB)
Enzymes [BR:ecj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     JW2447 (maeB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2574754..2577033)
Genome map
AA seq 759 aa AA seqDB search
MDDQLKQSALDFHEFPVPGKIQVSPTKPLATQRDLALAYSPGVAAPCLEIEKDPLKAYKY
TARGNLVAVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGIDVFDIEVDELDPDKFI
EVVAALEPTFGGINLEDIKAPECFYIEQKLRERMNIPVFHDDQHGTAIISTAAILNGLRV
VEKNISDVRMVVSGAGAAAIACMNLLVALGLQKHNIVVCDSKGVIYQGREPNMAETKAAY
AVVDDGKRTLDDVIEGADIFLGCSGPKVLTQEMVKKMARAPMILALANPEPEILPPLAKE
VRPDAIICTGRSDYPNQVNNVLCFPFIFRGALDVGATAINEEMKLAAVRAIAELAHAEQS
EVVASAYGDQDLSFGPEYIIPKPFDPRLIVKIAPAVAKAAMESGVATRPIADFDVYIDKL
TEFVYKTNLFMKPIFSQARKAPKRVVLPEGEEARVLHATQELVTLGLAKPILIGRPNVIE
MRIQKLGLQIKAGVDFEIVNNESDPRFKEYWTEYFQIMKRRGVTQEQAQRALISNPTVIG
AIMVQRGEADAMICGTVGDYHEHFSVVKNVFGYRDGVHTAGAMNALLLPSGNTFIADTYV
NDEPDAEELAEITLMAAETVRRFGIEPRVALLSHSNFGSSDCPSSSKMRQALELVRERAP
ELMIDGEMHGDAALVEAIRNDRMPDSSLKGSANILVMPNMEAARISYNLLRVSSSEGVTV
GPVLMGVAKPVHVLTPIASVRRIVNMVALAVVEAQTQPL
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggatgaccagttaaaacaaagtgcacttgatttccatgaatttccagttccagggaaa
atccaggtttctccaaccaagcctctggcaacacagcgcgatctggcgctggcctactca
ccaggcgttgccgcaccttgtcttgaaatcgaaaaagacccgttaaaagcctacaaatat
accgcccgaggtaacctggtggcggtgatctctaacggtacggcggtgctggggttaggc
aacattggcgcgctggcaggcaaaccggtgatggaaggcaagggcgttctgtttaagaaa
ttcgccgggattgatgtatttgacattgaagttgacgaactcgacccggacaaatttatt
gaagttgtcgccgcgctcgaaccaaccttcggcggcatcaacctcgaagacattaaagcg
ccagaatgtttctatattgaacagaaactgcgcgagcggatgaatattccggtattccac
gacgatcagcacggcacggcaattatcagcactgccgccatcctcaacggcttgcgcgtg
gtggagaaaaacatctccgacgtgcggatggtggtttccggcgcgggtgccgcagcaatc
gcctgtatgaacctgctggtagcgctgggtctgcaaaaacataacatcgtggtttgcgat
tcaaaaggcgttatctatcagggccgtgagccaaacatggcggaaaccaaagccgcatat
gcggtggtggatgacggcaaacgtaccctcgatgatgtgattgaaggcgcggatattttc
ctgggctgttccggcccgaaagtgctgacccaggaaatggtgaagaaaatggctcgtgcg
ccaatgatcctggcgctggcgaacccggaaccggaaattctgccgccgctggcgaaagaa
gtgcgtccggatgccatcatttgcaccggtcgttctgactatccgaaccaggtgaacaac
gtcctgtgcttcccgttcatcttccgtggcgcgctggacgttggcgcaaccgccatcaac
gaagagatgaaactggcggcggtacgtgcgattgcagaactcgcccatgcggaacagagc
gaagtggtggcttcagcgtatggcgatcaggatctgagctttggtccggaatacatcatt
ccaaaaccgtttgatccgcgcttgatcgttaagatcgctcctgcggtcgctaaagccgcg
atggagtcgggcgtggcgactcgtccgattgctgatttcgacgtctacatcgacaagctg
actgagttcgtttacaaaaccaacctgtttatgaagccgattttctcccaggctcgcaaa
gcgccgaagcgcgttgttctgccggaaggggaagaggcgcgcgttctgcatgccactcag
gaactggtaacgctgggactggcgaaaccgatccttatcggtcgtccgaacgtgatcgaa
atgcgcattcagaaactgggcttgcagatcaaagcgggcgttgattttgagatcgtcaat
aacgaatccgatccgcgctttaaagagtactggaccgaatacttccagatcatgaagcgt
cgcggcgtcactcaggaacaggcgcagcgggcgctgatcagtaacccgacagtgatcggc
gcgatcatggttcagcgtggggaagccgatgcaatgatttgcggtacggtgggtgattat
catgaacattttagcgtggtgaaaaatgtctttggttatcgcgatggcgttcacaccgca
ggtgccatgaacgcgctgctgctgccgagtggtaacacctttattgccgatacatatgtt
aatgatgaaccggatgcagaagagctggcggagatcaccttgatggcggcagaaactgtc
cgtcgttttggtattgagccgcgcgttgctttgttgtcgcactccaactttggttcttct
gactgcccgtcgtcgagcaaaatgcgtcaggcgctggaactggtcagggaacgtgcacca
gaactgatgattgatggtgaaatgcacggcgatgcagcgctggtggaagcgattcgcaac
gaccgtatgccggacagctctttgaaaggttccgccaatattctggtgatgccgaacatg
gaagctgcccgcattagttacaacttactgcgtgtttccagctcggaaggtgtgactgtc
ggcccggtgctgatgggtgtggcgaaaccggttcacgtgttaacgccgatcgcatcggtg
cgtcgtatcgtcaacatggtggcgctggccgtggtagaagcgcaaacccaaccgctgtaa

DBGET integrated database retrieval system