KEGG   Escherichia coli K-12 W3110: JW2448Help
Entry
JW2448            CDS       T00068                                 

Gene name
talA
Definition
(GenBank) transaldolase A
  KO
K00616  
transaldolase [EC:2.2.1.2]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ecj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    JW2448 (talA)
Enzymes [BR:ecj01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     JW2448 (talA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2577322..2578272
Genome map
AA seq 316 aa AA seqDB search
MNELDGIKQFTTVVADSGDIESIRHYHPQDATTNPSLLLKAAGLSQYEHLIDDAIAWGKK
NGKTQEQQVVAACDKLAVNFGAEILKIVPGRVSTEVDARLSFDKEKSIEKARHLVDLYQQ
QGVEKSRILIKLASTWEGIRAAEELEKEGINCNLTLLFSFAQARACAEAGVFLISPFVGR
IYDWYQARKPMDPYVVEEDPGVKSVRNIYDYYKQHHYETIVMGASFRRTEQILALTGCDR
LTIAPNLLKELQEKVSPVVRKLIPPSQTFPRPAPMSEAEFRWEHNQDAMAVEKLSEGIRL
FAVDQRKLEDLLAAKL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagttagacggcatcaaacagttcaccactgtcgtggcagacagcggcgatatt
gagtccattcgccattatcatccccaggatgccaccaccaatccttcgctgttactcaaa
gctgccggattatcacaatatgagcatttaatagacgatgctatcgcctggggtaaaaaa
aatggcaagacccaggaacaacaggtggtcgcagcgtgtgacaaactggcggtcaatttc
ggtgctgaaatcctcaaaatcgtacccggtcgcgtgtcaacagaagttgatgcacgcctc
tcttttgataaagaaaagagtattgagaaggcgcgccatctggtggacttgtatcagcaa
caaggcgttgagaaatcacgcattctgatcaagctggcttcgacctgggaaggaattcgc
gcggcagaagagctggaaaaagaaggtattaactgcaacctgacgctgctgttttctttt
gcacaggcacgggcctgtgcggaagcaggcgtttttctgatttcgccgtttgtcgggcgt
atttatgactggtatcaggcacgcaagccgatggacccgtatgtggtggaagaagatccg
ggcgttaaatcggtgcgcaatatctacgactactataagcaacaccactatgaaaccatt
gtgatgggcgcgagcttccgtcgcaccgaacaaatcctcgccttaaccggctgcgatcga
ctgactatcgcaccgaatttactgaaggagctgcaggaaaaagtttcgccagtggtacgt
aaattaatcccaccttctcagacgttcccacgcccagctcccatgagcgaagcggagttc
cgttgggagcacaatcaggatgcgatggcggtagaaaaactgtctgaaggcattcgtctg
ttcgccgttgatcaacgcaaactggaagatcttcttgccgccaaactataa

DBGET integrated database retrieval system