KEGG   Escherichia coli K-12 W3110: JW2669Help
Entry
JW2669            CDS       T00068                                 

Gene name
recA
Definition
(GenBank) DNA strand exchange and recombination protein with protease and nuclease activity
  KO
K03553  
recombination protein RecA
Organism
ecj  Escherichia coli K-12 W3110
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ecj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    JW2669 (recA)
DNA repair and recombination proteins [BR:ecj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     JW2669 (recA)
    RecFOR pathway proteins
     JW2669 (recA)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    JW2669 (recA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2821364..2822425)
Genome map
AA seq 353 aa AA seqDB search
MAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMG
RIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQP
DTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLA
GNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVG
SETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIG
QGKANATAWLKDNPETAKEIEKKVRELLLSNPNSTPDFSVDDSEGVAETNEDF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgacgaaaacaaacagaaagcgttggcggcagcactgggccagattgagaaa
caatttggtaaaggctccatcatgcgcctgggtgaagaccgttccatggatgtggaaacc
atctctaccggttcgctttcactggatatcgcgcttggggcaggtggtctgccgatgggc
cgtatcgtcgaaatctacggaccggaatcttccggtaaaaccacgctgacgctgcaggtg
atcgccgcagcgcagcgtgaaggtaaaacctgtgcgtttatcgatgctgaacacgcgctg
gacccaatctacgcacgtaaactgggcgtcgatatcgacaacctgctgtgctcccagccg
gacaccggcgagcaggcactggaaatctgtgacgccctggcgcgttctggcgcagtagac
gttatcgtcgttgactccgtggcggcactgacgccgaaagcggaaatcgaaggcgaaatc
ggcgactctcacatgggccttgcggcacgtatgatgagccaggcgatgcgtaagctggcg
ggtaacctgaagcagtccaacacgctgctgatcttcatcaaccagatccgtatgaaaatt
ggtgtgatgttcggtaacccggaaaccactaccggtggtaacgcgctgaaattctacgcc
tctgttcgtctcgacatccgtcgtatcggcgcggtgaaagagggcgaaaacgtggtgggt
agcgaaacccgcgtgaaagtggtgaagaacaaaatcgctgcgccgtttaaacaggctgaa
ttccagatcctctacggcgaaggtatcaacttctacggcgaactggttgacctgggcgta
aaagagaagctgatcgagaaagcaggcgcgtggtacagctacaaaggtgagaagatcggt
cagggtaaagcgaatgcgactgcctggctgaaagataacccggaaaccgcgaaagagatc
gagaagaaagtacgtgagttgctgctgagcaacccgaactcaacgccggatttctctgta
gatgatagcgaaggcgtagcagaaactaacgaagatttttaa

DBGET integrated database retrieval system