KEGG   Escherichia coli K-12 W3110: JW2987Help
Entry
JW2987            CDS       T00068                                 

Gene name
parC
Definition
(GenBank) DNA topoisomerase IV, subunit A
  KO
K02621  
topoisomerase IV subunit A [EC:5.99.1.-]
Organism
ecj  Escherichia coli K-12 W3110
Brite
Enzymes [BR:ecj01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.-  
     JW2987 (parC)
DNA replication proteins [BR:ecj03032]
 Prokaryotic Type
  DNA Topoisomerases
   JW2987 (parC)
Chromosome [BR:ecj03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    JW2987 (parC)
Prokaryotic defense system [BR:ecj02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    JW2987 (parC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3162371..3164629)
Genome map
AA seq 752 aa AA seqDB search
MSDMAERLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNASAKF
KKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRY
TESRLSKYSELLLSELGQGTADWVPNFDGTLQEPKMLPARLPNILLNGTTGIAVGMATDI
PPHNLREVAQAAIALIDQPKTTLDQLLDIVQGPDYPTEAEIITSRAEIRKIYENGRGSVR
MRAVWKKEDGAVVISALPHQVSGARVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIV
PRSNRVDMDQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILSEWLVFRRDTVRR
RLNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEPKPALMSRFGLTETQAEAILEL
KLRHLAKLEEMKIRGEQSELEKERDQLQGILASERKMNNLLKKELQADAQAYGDDRRSPL
QEREEAKAMSEHDMLPSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAVKGKSN
QPVVFVDSTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVDHMLMESDDQKLLMASDA
GYGFVCTFNDLVARNRAGKALITLPENAHVMPPVVIEDASDMLLAITQAGRMLMFPVSDL
PQLSKGKGNKIINIPSAEAARGEDGLAQLYVLPPQSTLTIHVGKRKIKLRPEELQKVTGE
RGRRGTLMRGLQRIDRVEIDSPRRASSGDSEE
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatatggcagagcgccttgcgctacatgaatttacggaaaacgcctacttaaac
tactccatgtacgtgatcatggaccgtgcgttgccgtttattggtgatggtctgaaacct
gttcagcgccgcattgtgtatgcgatgtctgaactgggcctgaatgccagcgccaaattt
aaaaaatcggcccgtaccgtcggtgacgtactgggtaaataccatccgcacggcgatagc
gcctgttatgaagcgatggtcctgatggcgcaaccgttctcttaccgttatccgctggtt
gatggtcaggggaactggggcgcgccggacgatccgaaatcgttcgcggcaatgcgttac
accgaatcccggttgtcgaaatattccgagctgctattgagcgagctggggcaggggacg
gctgactgggtgccaaacttcgacggcactttgcaggagccgaaaatgctacctgcccgt
ctgccaaacattttgcttaacggcaccaccggtattgccgtcggcatggcgaccgatatt
ccaccgcataacctgcgtgaagtggctcaggcggcaatcgcattaatcgaccagccgaaa
accacgctcgatcagctgctggatatcgtgcaggggccggattatccgactgaagcggaa
attatcacttcgcgcgccgagatccgtaaaatctacgagaacggacgtggttcagtgcgt
atgcgcgcggtgtggaagaaagaagatggcgcggtggttatcagcgcattgccgcatcag
gtttcaggtgcgcgcgtactggagcaaattgctgcgcaaatgcgcaacaaaaagctgccg
atggttgacgatctgcgcgatgaatctgaccacgagaacccgacccgcctggtgattgtg
ccgcgttccaaccgcgtggatatggatcaggtgatgaaccacctcttcgctaccaccgat
ctggaaaagagctatcgtattaaccttaatatgatcggtctggatggtcgtccggcggtg
aaaaacctgctggaaatcctctccgaatggctggtgttccgccgcgataccgtgcgccgc
cgactgaactatcgtctggagaaagtcctcaagcgcctgcatatcctcgaaggtttgctg
gtggcgtttctcaatatcgacgaagtgattgagatcattcgtaatgaagatgaaccgaaa
ccggcgctgatgtcgcggtttggccttacggaaacccaggcggaagcgatcctcgaactg
aaactgcgtcatcttgccaaactggaagagatgaagattcgcggtgagcagagtgaactg
gaaaaagagcgcgaccagttgcagggcattttggcttccgagcgtaaaatgaataacctg
ctgaagaaagaactgcaggcagacgcgcaagcctacggtgacgatcgtcgttcgccgttg
caggaacgcgaagaagcgaaagcgatgagcgagcacgacatgctgccgtctgaacctgtc
accattgtgctgtcgcagatgggctgggtacgcagcgctaaaggccatgatatcgacgcg
ccgggcctgaattataaagcgggtgatagcttcaaagcggcggtgaaaggtaagagcaac
caaccggtagtgtttgttgattccaccggtcgtagctatgccattgacccgattacgctg
ccgtcggcgcgtggtcagggcgagccgctcaccggcaaattaacgttgccgcctggggcg
accgttgaccatatgctgatggaaagcgacgatcagaaactgctgatggcttccgatgcg
ggttacggtttcgtctgcacctttaacgatctggtggcgcgtaaccgtgcaggtaaggct
ttgatcaccttaccggaaaatgcccatgttatgccgccggtggtgattgaagatgcttcc
gatatgctgctggcaatcactcaggcaggccgtatgttgatgttcccggtaagtgatctg
ccgcagctgtcgaagggcaaaggcaacaagattatcaacattccatcggcagaagccgcg
cgtggagaagatggtctggcgcaattgtacgttctgccgccgcaaagcacgctgaccatt
catgttgggaaacgcaaaattaaactgcgcccggaagagttacagaaagtcactggcgaa
cgtggacgccgcggtacgttgatgcgcggtttgcagcgtatcgatcgtgttgagatcgac
tctcctcgccgtgccagcagcggtgatagcgaagagtaa

DBGET integrated database retrieval system