KEGG   Escherichia coli K-12 W3110: JW3290Help
Entry
JW3290            CDS       T00068                                 

Gene name
gspG
Definition
(GenBank) pseudopilin, cryptic, general secretion pathway
  KO
K02456  
general secretion pathway protein G
Organism
ecj  Escherichia coli K-12 W3110
Pathway
Bacterial secretion system
Module
Type II general secretion pathway
Brite
KEGG Orthology (KO) [BR:ecj00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    JW3290 (gspG)
Secretion system [BR:ecj02044]
 Type II secretion system
  General secretion pathway protein [MD:M00331]
   JW3290 (gspG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4178956..4179393)
Genome map
AA seq 145 aa AA seqDB search
MRATDKQRGFTLLEIMVVIVIIGVLASLVVPNLMGNKEKADKQKAVSDIVALENALDMYK
LDNHHYPTTNQGLESLVEAPTLPPLAANYNKEGYIKRLPADPWGNDYVLVNPGEHGAYDL
LSAGPDGEMGTEDDITNWGLSKKKK
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcaacggataagcaacgcggttttacattactggaaattatggtggtgatcgtc
attatcggcgtacttgccagcctggtggttcctaacctaatgggcaataaagaaaaggcg
gataagcaaaaagccgtcagcgatattgtggcgctggaaaacgcccttgatatgtacaaa
ctcgacaatcatcactatccaaccacaaatcaggggcttgaatccttagtagaagcgccg
acactgccaccgctggccgcaaactataacaaggaaggttatatcaagcgtctgcctgcc
gatccctggggcaatgattatgtcctcgttaatcctggtgaacatggtgcatacgatctg
ctttcagcagggcccgatggtgaaatgggaaccgaggacgacatcaccaactggggtttg
agcaagaagaaaaagtaa

DBGET integrated database retrieval system