KEGG   Escherichia coli K-12 W3110: JW3323Help
Entry
JW3323            CDS       T00068                                 

Gene name
pabA
Definition
(GenBank) aminodeoxychorismate synthase, subunit II
  KO
K01664  
para-aminobenzoate synthetase component II [EC:2.6.1.85]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:ecj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    JW3323 (pabA)
Enzymes [BR:ecj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.85  aminodeoxychorismate synthase
     JW3323 (pabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4149587..4150150
Genome map
AA seq 187 aa AA seqDB search
MILLIDNYDSFTWNLYQYFCELGADVLVKRNDALTLADIDALKPQKIVISPGPCTPDEAG
ISLDVIRHYAGRLPILGVCLGHQAMAQAFGGKVVRAAKVMHGKTSPITHNGEGVFRGLAN
PLTVTRYHSLVVEPDSLPACFDVTAWSETREIMGIRHRQWDLEGVQFHPESILSEQGHQL
LANFLHR
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgcttatagataactacgattcttttacctggaacctctaccagtacttttgt
gaactgggggcggatgtgctggttaagcgcaacgatgcgttgacgctggcggatatcgac
gcccttaaaccacaaaaaattgtcatctcacctggcccctgtacgccagatgaagccggg
atctcccttgacgttattcgccactatgccgggcgcttgccgattcttggcgtctgcctc
ggtcatcaggcaatggcgcaggcatttggcggtaaagttgtgcgcgccgcaaaggtcatg
cacggcaaaacctcgccgattacacataacggtgagggcgtatttcgggggctggcaaat
ccacttaccgtgacacgctaccattcgctggtggtggaacctgactcattaccagcgtgc
tttgacgtgacggcctggagcgaaacccgagagattatggggattcgccatcgccagtgg
gatctggaaggtgtgcagttccatccagaaagtattcttagcgaacaaggacatcaactg
ctggctaatttcctgcatcgctga

DBGET integrated database retrieval system