KEGG   Escherichia coli K-12 W3110: JW4022Help
Entry
JW4022            CDS       T00068                                 

Gene name
yjcC
Definition
(GenBank) predicted signal transduction protein
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4279061..4280647
Genome map
AA seq 528 aa AA seqDB search
MSHRARHQLLALPGIIFLVLFPIILSLWIAFLWAKSEVNNQLRTFAQLALDKSELVIRQA
DLVSDAAERYQGQVCTPAHQKRMLNIIRGYLYINELIYARDNHFLCSSLIAPVNGYTIAP
ADYKREPNVSIYYYRDTPFFSGYKMTYMQRGNYVAVINPLFWSEVMSDDPTLQWGVYDTV
TKTFFSLSKEASAATFSPLIHLKDLTVQRNGYLYATVYSTKRPIAAIVATSYQRLITHFY
NHLIFALPAGILGSLVLLLLWLRIRQNYLSPKRKLQRALEKHQLCLYYQPIIDIKTEKCI
GAEALLRWPGEQGQIMNPAEFIPLAEKEGMIEQITDYVIDNVFRDLGDYLATHADRYVSI
NLSASDFHTSRLIARINQKTEQYAVRPQQIKFEVTEHAFLDVDKMTPIILAFRQAGYEVA
IDDFGIGYSNLHNLKSLNVDILKIDKSFVETLTTHKTSHLIAEHIIELAHSLGLKTIAEG
VETEEQVNWLRKRGVRYCQGWFFAKAMPPQVFMQWMEQLPARELTRGQ
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatcgtgcacgacaccaattactggcgttgccgggcattatctttttagttctc
tttcccatcattctttcgctatggattgccttcctttgggcaaaatcagaagtgaataat
cagctccgaacctttgctcaactggcactggataaatccgagctggtcattcgccaggca
gatttagtgagcgatgcagctgaacgctatcaggggcaagtttgcactccagcccatcaa
aagcgaatgttgaatattattcgtggctatctttatattaatgaattgatctatgcccgt
gataaccattttttatgctcatcgctgatagcgcctgtaaacggctatacgattgcaccg
gccgattataagcgtgaacctaacgtttctatctattattaccgcgatacgccttttttc
tctggctataaaatgacctatatgcagcggggaaattatgtggcggttatcaaccctctc
ttctggagtgaagtgatgtctgatgacccgacattgcaatggggtgtgtatgatacggtg
acgaaaacctttttctcgttaagcaaagaggcctcggcagcaacgttttctccgctgatt
catttgaaggatttaaccgtacaaagaaatggctatttatatgcgacagtttattcgaca
aaacgcccaattgcagccattgttgcgacttcatatcaacgtcttataacccatttttat
aatcatcttatttttgcgttgcccgccggtattttggggagtcttgttctgctattactc
tggctacgtattcgacaaaactatttatctcccaaacgtaaattgcaacgcgccctcgaa
aaacatcaactttgtctttattaccagccaataatcgatatcaaaacagaaaaatgtatc
ggcgctgaagcgttgttacgttggcctggtgagcaggggcaaataatgaatccggcagag
tttattccgctggcagaaaaggaggggatgatagaacagataactgattatgttattgat
aatgtcttccgcgatctgggcgattacctggcaacacatgcagatcgctatgtttctatt
aacctgtcggcctccgattttcatacgtcacggttgatagcgcgaatcaatcagaaaaca
gagcaatacgcggtgcgtccgcagcaaattaaatttgaagtgactgagcatgcatttctt
gatgttgacaaaatgacgccgattattctggctttccgccaggcaggttacgaagtggca
attgatgattttggtattggctactctaacttgcataaccttaaatcattgaatgtcgat
attttgaaaatcgacaaatcgtttgttgaaacgctgaccacccacaaaaccagtcatttg
attgcggaacacatcatcgagctggcgcacagcctggggttaaaaacgatcgctgaaggc
gtcgaaactgaggagcaggttaactggctgcgcaaacgcggcgtgcgctattgccaggga
tggttctttgcgaaggcgatgccgccgcaggtgtttatgcaatggatggagcaattaccc
gcgcgggagttaacgcgcgggcaataa

DBGET integrated database retrieval system