KEGG   Escherichia coli K-12 W3110: JW4159Help
Entry
JW4159            CDS       T00068                                 

Gene name
priB
Definition
(GenBank) primosomal protein N
  KO
K02686  
primosomal replication protein N
Organism
ecj  Escherichia coli K-12 W3110
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ecj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    JW4159 (priB)
DNA repair and recombination proteins [BR:ecj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     JW4159 (priB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
4430200..4430514
Genome map
AA seq 104 aa AA seqDB search
MTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQ
AITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSGD
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccgtctggtgttgtccggcaccgtgtgcagggctccccttcgaaaggtcagt
ccatcaggaattcctcactgccagttcgtgcttgagcatcgttctgtgcaggaggaagcc
ggctttcaccggcaggcgtggtgtcaaatgcccgttattgttagcggacacgaaaaccag
gccattactcacagtataacggtcggcagtcgcataaccgttcaggggttcatttcatgc
cacaaggcaaagaacggactgagcaaaatggttttgcatgccgagcagattgaattgata
gattctggagactag

DBGET integrated database retrieval system