KEGG   Escherichia coli K-12 W3110: JW5286Help
Entry
JW5286            CDS       T00068                                 

Gene name
ynjD
Definition
(GenBank) predicted transporter subunit
  KO
K05779  
putative thiamine transport system ATP-binding protein
Organism
ecj  Escherichia coli K-12 W3110
Module
Putative thiamine transport system
Brite
Transporters [BR:ecj02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putative thiamine transporter [MD:M00192] [OT]
    JW5286 (ynjD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1840461..1841114
Genome map
AA seq 217 aa AA seqDB search
MLCVKNVSLRLPESRLLTNVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALAEQFSCTGE
LWLNEQRIDILPTAQRQIGILFQDALLFDQFSVGQNLLLALPATLKGNARRNAVNDALER
SGLEGAFHQDPATLSGGQRARVALLRALLAQPKALLLDEPFSRLDVALRDNFRQWVFSEV
RALAIPVVQVTHDLQDVPADSSVLDMAQWSENYNKLR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgctctgcgtgaaaaatgtttcgctacgtttaccagaaagccgcttgctgacaaacgtt
aactttacggtggataaaggtgacattgtcacgttaatggggccgtctggctgtggaaaa
tccactctgttttcatggatgattggtgcactggccgaacagttttcttgtacaggtgag
ctatggctcaatgagcaacggattgacatcctacccaccgcacagcgtcagattggcatt
ctttttcaggatgcactgttatttgaccagttcagtgtcgggcaaaatttactgctggcg
ctaccggcgacacttaaagggaatgcccgacgtaatgccgtgaatgatgcacttgagcgt
tcaggccttgagggagctttccatcaggatcctgccactttgtctggcggtcagcgagcg
cgcgttgctctactacgcgcccttctcgcccaaccaaaagcgttactcctggatgagcca
ttcagccgtcttgatgtggctctgcgcgataattttcgccagtgggtgttcagcgaagtt
cgcgccctggcgatccccgtcgttcaggtaacgcacgatctccaggatgttcctgctgat
agttctgttctggatatggcgcagtggtcagaaaattacaacaaactgcgataa

DBGET integrated database retrieval system