KEGG   Escherichia coli K-12 W3110: JW5468Help
Entry
JW5468            CDS       T00068                                 

Gene name
ygfS
Definition
(GenBank) predicted oxidoreductase, 4Fe-4S ferredoxin-type subunit
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3027180..3027668)
Genome map
AA seq 162 aa AA seqDB search
MKSLIIVNPADCIGCRTCEVACVVAHPSEQELNADVFLPRLKVQRLDSISAPVMCHQCEN
APCVGACPVGALTMGEQVVQTNSARCIGCQSCVSACPFGMITIQSLPGDTRQQIVKCDLC
EQREEGPACVESCPTQALQLLTERELRRVRQQRIVASGENPL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgttaattatcgttaatccggctgactgtattggctgccgtacttgtgaagta
gcctgtgtggtcgctcacccttcagaacaggagttgaatgccgatgtctttttaccccgg
ctgaaggtacagcgactggacagcatcagtgcgccggtgatgtgccatcagtgtgaaaac
gccccttgtgttggcgcttgccccgtgggggcgctgacgatgggcgagcaggtggtgcag
accaattctgcccgttgtattggctgtcagagttgcgtcagtgcgtgcccgtttggaatg
atcaccattcagtcgttgccgggggatacccgacaacaaattgtgaaatgcgatctctgt
gaacagcgggaagaggggccagcctgcgttgaatcttgcccaacacaggcgctgcagttg
cttactgaaagagaactcaggcgagtccgccagcagcgtattgttgccagcggtgagaat
cctctctga

DBGET integrated database retrieval system