KEGG   Escherichia coli K-12 W3110: JW5531Help
Entry
JW5531            CDS       T00068                                 

Gene name
deaD
Definition
(GenBank) ATP-dependent RNA helicase
  KO
K05592  
ATP-dependent RNA helicase DeaD [EC:3.6.4.13]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:ecj00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    JW5531 (deaD)
Enzymes [BR:ecj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     JW5531 (deaD)
Messenger RNA biogenesis [BR:ecj03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     JW5531 (deaD)
Ribosome biogenesis [BR:ecj03009]
 Prokaryotic Type
  rRNA helicases
   JW5531 (deaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3305826..3307715)
Genome map
AA seq 629 aa AA seqDB search
MAEFETTFADLGLKAPILEALNDLGYEKPSPIQAECIPHLLNGRDVLGMAQTGSGKTAAF
SLPLLQNLDPELKAPQILVLAPTRELAVQVAEAMTDFSKHMRGVNVVALYGGQRYDVQLR
ALRQGPQIVVGTPGRLLDHLKRGTLDLSKLSGLVLDEADEMLRMGFIEDVETIMAQIPEG
HQTALFSATMPEAIRRITRRFMKEPQEVRIQSSVTTRPDISQSYWTVWGMRKNEALVRFL
EAEDFDAAIIFVRTKNATLEVAEALERNGYNSAALNGDMNQALREQTLERLKDGRLDILI
ATDVAARGLDVERISLVVNYDIPMDSESYVHRIGRTGRAGRAGRALLFVENRERRLLRNI
ERTMKLTIPEVELPNAELLGKRRLEKFAAKVQQQLESSDLDQYRALLSKIQPTAEGEELD
LETLAAALLKMAQGERTLIVPPDAPMRPKREFRDRDDRGPRDRNDRGPRGDREDRPRRER
RDVGDMQLYRIEVGRDDGVEVRHIVGAIANEGDISSRYIGNIKLFASHSTIELPKGMPGE
VLQHFTRTRILNKPMNMQLLGDAQPHTGGERRGGGRGFGGERREGGRNFSGERREGGRGD
GRRFSGERREGRAPRRDDSTGRRRFGGDA
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattcgaaaccacttttgcagatctgggcctgaaggctcctatccttgaagcc
cttaacgatctgggttacgaaaaaccatctccaattcaggcagagtgtattccacatctg
ctgaatggccgcgacgttctgggtatggcccagacggggagcggaaaaactgcagcattc
tctttacctctgttgcagaatcttgatcctgagctgaaagcaccacagattctggtgctg
gcaccgacccgcgaactggcggtacaggttgctgaagcaatgacggatttctctaaacac
atgcgcggcgtaaatgtggttgctctgtacggcggccagcgttatgacgtgcaattacgc
gccctgcgtcaggggccgcagatcgttgtcggtactccgggccgtctgctggaccacctg
aaacgtggcactctggacctctctaaactgagcggtctggttctggatgaagctgacgaa
atgctgcgcatgggcttcatcgaagacgttgaaaccattatggcgcagatcccggaaggt
catcagaccgctctgttctctgcaaccatgccggaagcgattcgtcgcattacccgccgc
tttatgaaagagccgcaggaagtgcgcattcagtccagcgtgactacccgtcctgacatc
agccagagctactggactgtctggggtatgcgcaaaaacgaagcactggtacgtttcctg
gaagcggaagattttgatgcggcgattatcttcgttcgtaccaaaaacgcgactctggaa
gtggctgaagctcttgagcgtaacggctacaacagcgccgcgctgaacggtgacatgaac
caggcgctgcgtgaacagacactggaacgcctgaaagatggtcgtctggacatcctgatt
gcgaccgacgttgcagcccgtggcctggacgttgagcgtatcagcctggtagttaactac
gatatcccgatggattctgagtcttacgttcaccgtatcggtcgtaccggtcgtgcgggt
cgtgctggccgcgcgctgctgttcgttgagaaccgcgagcgtcgtctgctgcgcaacatt
gaacgtactatgaagctgactattccggaagtagaactgccgaacgcagaactgctaggc
aaacgccgtctggaaaaattcgccgctaaagtacagcagcagctggaaagcagcgatctg
gatcaataccgcgcactgctgagcaaaattcagccgactgctgaaggtgaagagctggat
ctcgaaactctggctgcggcactgctgaaaatggcacagggtgaacgtactctgatcgta
ccgccagatgcgccgatgcgtccgaaacgtgaattccgtgaccgtgatgaccgtggtccg
cgcgatcgtaacgaccgtggcccgcgtggtgaccgtgaagatcgtccgcgtcgtgaacgt
cgtgatgttggcgatatgcagctgtaccgcattgaagtgggccgcgatgatggtgttgaa
gttcgtcatatcgttggtgcgattgctaacgaaggcgacatcagcagccgttacattggt
aacatcaagctgtttgcttctcactccaccatcgaactgccgaaaggtatgccgggtgaa
gtgctgcaacactttacgcgcactcgcattctcaacaagccgatgaacatgcagttactg
ggcgatgcacagccgcatactggcggtgagcgtcgtggcggtggtcgtggtttcggtggc
gaacgtcgtgaaggcggtcgtaacttcagcggtgaacgccgtgaaggtggccgtggtgat
ggtcgtcgttttagcggcgaacgtcgtgaaggccgcgctccgcgtcgtgatgattctacc
ggtcgtcgtcgtttcggtggtgatgcgtaa

DBGET integrated database retrieval system