KEGG   Escherichia coli K-12 W3110: JW5691Help
Entry
JW5691            CDS       T00068                                 

Gene name
gntX
Definition
(GenBank) gluconate periplasmic binding protein with phosphoribosyltransferase domain, GNT I system
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran PRTase_2 UPRTase DZR zf-C3HC4_3
Motif
Other DBs
NCBI-ProteinID: BAE77878
UniProt: P46846
Position
complement(4094851..4095534)
Genome map
AA seq 227 aa AA seqDB search
MLTVPGLCWLCRMPLALGHWGICSVCSRATRTDKTLCPQCGLPATHSHLPCGRCLQKPPP
WQRLVTVADYAPPLSPLIHQLKFSRRSEIASALSRLLLLEVLHARRTTGLQLPDRIVSVP
LWQRRHWRRGFNQSDLLCQPLSRWLHCQWDSEAVTRTRATATQHFLSARLRKRNLKNAFR
LELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAAAVQVWCLCRTL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgctaacagtaccgggattatgctggctatgccgaatgccactggcgttaggtcattgg
gggatttgttcggtctgttcacgcgccacccgcacagataaaacgttatgcccacaatgt
ggattacccgccacacactcccatcttccctgcggtcgctgcctgcaaaaaccgccgccc
tggcaaagactggtcacggttgccgactatgcgccgccgttaagtccgcttatccaccag
cttaaattttcccggcgcagtgaaatcgccagcgccctgtcacgtctgttactattggaa
gtcttacacgctcgtcgcaccaccgggttgcaattgccggatcgcatcgtcagcgttccg
ttatggcagcggcgtcactggcgtcggggatttaatcagagcgatttgctgtgtcagccg
ttatcacgctggttgcactgccaatgggatagcgaagccgtcacacgtacacgggccact
gcgacccagcattttctcagtgcccggctgcgcaagcgcaacctgaaaaatgcctttcgt
cttgaattgcccgtgcaaggtcgccatatggtgattgtggatgatgtcgttaccaccgga
agtaccgtcgcagagattgcgcagttgcttttacgcaatggtgcggcggctgtccaggtc
tggtgcctttgtcgaaccttgtag

DBGET integrated database retrieval system