KEGG   Escherichia coli K-12 W3110: Y75_p0084Help
Entry
Y75_p0084         CDS       T00068                                 

Gene name
murE
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate:meso-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ecj00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Y75_p0084 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Y75_p0084 (murE)
Enzymes [BR:ecj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Y75_p0084 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Nara: 
Wisconsin: 
UniProt: 
Structure
PDB: 

Jmol
Position
93166..94653
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLLAPWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGV
AAIIAEAKDEATDGEIREMHGVPVIYLSQLNERLSALAGRFYHEPSDNLRLVGVTGTNGK
TTTTQLLAQWSQLLGEISAVMGTVGNGLLGKVIPTENTTGSAVDVQHELAGLVDQGATFC
AMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMEHYEAAKWLLYSEHHCGQAIIN
ADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKATEVNYHDSGATIRFSSSWGDGEIE
SHLMGAFNVSNLLLALATLLALGYPLADLLKTAARLQPVCGRMEVFTAPGKPTVVVDYAH
TPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMGAIAEEFADVAVVTDDNPRTEE
PRAIINDILAGMLDAGHAKVMEGRAEAVTCAVMQAKENDVVLVAGKGHEDYQIVGNQRLD
YSDRVTVARLLGVIA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgaccttcttgctccgtgggtgccagacgcaccttcgcga
gcactgcgagagatgacactcgacagccgtgtggctgcggcgggcgatctctttgtagct
gtagtaggtcatcaggcggacgggcgtcgatatatcccgcaggcgatagcgcaaggtgtg
gctgccattattgcagaggcgaaagatgaggcgaccgatggtgaaatccgtgaaatgcac
ggcgtaccggtcatctatctcagccagctcaacgagcgtttatctgcactggcgggccgc
ttttaccatgaaccctctgacaatttacgtctcgtgggcgtaacgggcaccaacggcaaa
accacgactacccagctgttggcgcagtggagccaactgcttggcgaaatcagcgcggta
atgggcaccgttggtaacggcctgctggggaaagtgatcccgacagaaaatacaaccggt
tcggcagtcgatgttcagcatgagctggcggggctggtggatcagggcgcgacgttttgc
gcaatggaagtttcctcccacgggctggtacagcaccgtgtggcggcattgaaatttgcg
gcgtcggtctttaccaacttaagccgcgatcaccttgattatcatggtgatatggaacac
tacgaagccgcgaaatggctgctttattctgagcatcattgcggtcaggcgattattaac
gccgacgatgaagtgggccgccgctggctggcaaaactgccggacgcggttgcggtatca
atggaagatcatattaatccgaactgtcacggacgctggttgaaagcgaccgaagtgaac
tatcacgacagcggtgcgacgattcgctttagctcaagttggggcgatggcgaaattgaa
agccatctgatgggcgcttttaacgtcagcaacctgctgctcgcgctggcgacactgttg
gcactcggctatccactggctgatctgctgaaaaccgccgcgcgtctgcaaccggtttgc
ggacgtatggaagtgttcactgcgccaggcaaaccgacggtggtggtggattacgcgcat
acgccggatgcactggaaaaagccttacaggcggcgcgtctgcactgtgcgggcaagctg
tggtgtgtctttggctgtggtggcgatcgcgataaaggtaagcgtccactgatgggcgca
attgccgaagagtttgctgacgtggcggtggtgacggacgataacccgcgtaccgaagaa
ccgcgtgccatcatcaacgatattctggcgggaatgttagatgccggacatgccaaagtg
atggaaggccgtgctgaagcggtgacttgcgccgttatgcaggctaaagagaatgatgtg
gtactggtcgcgggcaaaggccatgaagattaccagattgttggcaatcagcgtctggac
tactccgatcgcgtcacggtggcgcgtctgctgggggtgattgcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system