KEGG   Escherichia coli K-12 W3110: Y75_p0333Help
Entry
Y75_p0333         CDS       T00068                                 

Gene name
lacZ
Definition
beta-D-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ecj00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ecj00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ecj00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Nara: 
Wisconsin: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(362455..365529)
Genome map
AA seq 1024 aa AA seqDB search
MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR
FAWFPAPEAVPESWLECDLPEADTVVVPSNWQMHGYDAPIYTNVTYPITVNPPFVPTENP
TGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYGQDSRLPSEFDLSAFLRA
GENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQISDFHVATRFNDDFSRAV
LEAEVQMCGELRDYLRVTVSLWQGETQVASGTAPFGGEIIDERGGYADRVTLRLNVENPK
LWSAEIPNLYRAVVELHTADGTLIEAEACDVGFREVRIENGLLLLNGKPLLIRGVNRHEH
HPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGLYVVDEANIETHG
MVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPSVIIWSLGNESGHGANHDALYRWIKSVD
PSRPVQYEGGGADTTATDIICPMYARVDEDQPFPAVPKWSIKKWLSLPGETRPLILCEYA
HAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSLIKYDENGNPWSAYGGDFGDTPNDR
QFCMNGLVFADRTPHPALTEAKHQQQFFQFRLSGQTIEVTSEYLFRHSDNELLHWMVALD
GKPLASGEVPLDVAPQGKQLIELPELPQPESAGQLWLTVRVVQPNATAWSEAGHISAWQQ
WRLAENLSVTLPAASHAIPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTP
LRDQFTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTA
HAWQHQGKTLFISRKTYRIDGSGQMAITVDVEVASDTPHPARIGLNCQLAQVAERVNWLG
LGPQENYPDRLTAACFDRWDLPLSDMYTPYVFPSENGLRCGTRELNYGPHQWRGDFQFNI
SRYSQQQLMETSHRHLLHAEEGTWLNIDGFHMGIGGDDSWSPSVSAEFQLSAGRYHYQLV
WCQK
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgattacggattcactggccgtcgttttacaacgtcgtgactgggaaaaccct
ggcgttacccaacttaatcgccttgcagcacatccccctttcgccagctggcgtaatagc
gaagaggcccgcaccgatcgcccttcccaacagttgcgcagcctgaatggcgaatggcgc
tttgcctggtttccggcaccagaagcggtgccggaaagctggctggagtgcgatcttcct
gaggccgatactgtcgtcgtcccctcaaactggcagatgcacggttacgatgcgcccatc
tacaccaacgtgacctatcccattacggtcaatccgccgtttgttcccacggagaatccg
acgggttgttactcgctcacatttaatgttgatgaaagctggctacaggaaggccagacg
cgaattatttttgatggcgttaactcggcgtttcatctgtggtgcaacgggcgctgggtc
ggttacggccaggacagtcgtttgccgtctgaatttgacctgagcgcatttttacgcgcc
ggagaaaaccgcctcgcggtgatggtgctgcgctggagtgacggcagttatctggaagat
caggatatgtggcggatgagcggcattttccgtgacgtctcgttgctgcataaaccgact
acacaaatcagcgatttccatgttgccactcgctttaatgatgatttcagccgcgctgta
ctggaggctgaagttcagatgtgcggcgagttgcgtgactacctacgggtaacagtttct
ttatggcagggtgaaacgcaggtcgccagcggcaccgcgcctttcggcggtgaaattatc
gatgagcgtggtggttatgccgatcgcgtcacactacgtctgaacgtcgaaaacccgaaa
ctgtggagcgccgaaatcccgaatctctatcgtgcggtggttgaactgcacaccgccgac
ggcacgctgattgaagcagaagcctgcgatgtcggtttccgcgaggtgcggattgaaaat
ggtctgctgctgctgaacggcaagccgttgctgattcgaggcgttaaccgtcacgagcat
catcctctgcatggtcaggtcatggatgagcagacgatggtgcaggatatcctgctgatg
aagcagaacaactttaacgccgtgcgctgttcgcattatccgaaccatccgctgtggtac
acgctgtgcgaccgctacggcctgtatgtggtggatgaagccaatattgaaacccacggc
atggtgccaatgaatcgtctgaccgatgatccgcgctggctaccggcgatgagcgaacgc
gtaacgcgaatggtgcagcgcgatcgtaatcacccgagtgtgatcatctggtcgctgggg
aatgaatcaggccacggcgctaatcacgacgcgctgtatcgctggatcaaatctgtcgat
ccttcccgcccggtgcagtatgaaggcggcggagccgacaccacggccaccgatattatt
tgcccgatgtacgcgcgcgtggatgaagaccagcccttcccggctgtgccgaaatggtcc
atcaaaaaatggctttcgctacctggagagacgcgcccgctgatcctttgcgaatacgcc
cacgcgatgggtaacagtcttggcggtttcgctaaatactggcaggcgtttcgtcagtat
ccccgtttacagggcggcttcgtctgggactgggtggatcagtcgctgattaaatatgat
gaaaacggcaacccgtggtcggcttacggcggtgattttggcgatacgccgaacgatcgc
cagttctgtatgaacggtctggtctttgccgaccgcacgccgcatccagcgctgacggaa
gcaaaacaccagcagcagtttttccagttccgtttatccgggcaaaccatcgaagtgacc
agcgaatacctgttccgtcatagcgataacgagctcctgcactggatggtggcgctggat
ggtaagccgctggcaagcggtgaagtgcctctggatgtcgctccacaaggtaaacagttg
attgaactgcctgaactaccgcagccggagagcgccgggcaactctggctcacagtacgc
gtagtgcaaccgaacgcgaccgcatggtcagaagccgggcacatcagcgcctggcagcag
tggcgtctggcggaaaacctcagtgtgacgctccccgccgcgtcccacgccatcccgcat
ctgaccaccagcgaaatggatttttgcatcgagctgggtaataagcgttggcaatttaac
cgccagtcaggctttctttcacagatgtggattggcgataaaaaacaactgctgacgccg
ctgcgcgatcagttcacccgtgcaccgctggataacgacattggcgtaagtgaagcgacc
cgcattgaccctaacgcctgggtcgaacgctggaaggcggcgggccattaccaggccgaa
gcagcgttgttgcagtgcacggcagatacacttgctgatgcggtgctgattacgaccgct
cacgcgtggcagcatcaggggaaaaccttatttatcagccggaaaacctaccggattgat
ggtagtggtcaaatggcgattaccgttgatgttgaagtggcgagcgatacaccgcatccg
gcgcggattggcctgaactgccagctggcgcaggtagcagagcgggtaaactggctcgga
ttagggccgcaagaaaactatcccgaccgccttactgccgcctgttttgaccgctgggat
ctgccattgtcagacatgtataccccgtacgtcttcccgagcgaaaacggtctgcgctgc
gggacgcgcgaattgaattatggcccacaccagtggcgcggcgacttccagttcaacatc
agccgctacagtcaacagcaactgatggaaaccagccatcgccatctgctgcacgcggaa
gaaggcacatggctgaatatcgacggtttccatatggggattggtggcgacgactcctgg
agcccgtcagtatcggcggaattccagctgagcgccggtcgctaccattaccagttggtc
tggtgtcaaaaataa

DBGET integrated database retrieval system