KEGG   Escherichia coli K-12 W3110: Y75_p0472Help
Entry
Y75_p0472         CDS       T00068                                 

Gene name
ybaS
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ecj00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ecj00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:ecj00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Nara: 
Wisconsin: 
UniProt: 
Structure
PDB: 

Jmol
Position
510865..511797
Genome map
AA seq 310 aa AA seqDB search
MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDGNVYSAGDSDY
RFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGA
IATTSLINAENVEQRWQRILHIQQQLAGEQVALSDEVNQSEQTTNFHNRAIAWLLYSAGY
LYCDAMEACDVYTRQCSTLLNTIELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMM
EGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEDGNSVRGQKMVASVA
KQLGYNVFKG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaacaaattacagcaggcagtggatcaggcttacacccaatttcactca
cttaacggcggacaaaatgccgattacattccctttctggcgaatgtaccaggtcaactg
gcggcagtggctatcgtgacctgcgatggcaacgtctatagtgcgggtgacagtgattac
cgctttgcactggaatccatctcgaaagtctgtacgttagcccttgcgttagaagatgtc
ggcccgcaggcggtacaggacaaaattggcgctgacccgaccggattgccctttaactca
gttatcgccttagagttgcatggcggcaaaccgctttcgccactggtaaatgctggcgct
attgccaccaccagcctgattaacgctgaaaatgttgaacaacgctggcagcgaatttta
catatccaacagcaactggctggcgagcaggtagcgctctctgacgaagtcaaccagtcg
gaacaaacaaccaacttccataaccgggccatagcctggctgctgtactccgccggatat
ctctattgtgatgcaatggaagcctgtgacgtgtatacccgtcagtgctccacgctcctc
aatactattgaactggcaacgcttggcgcgacgctggcggcaggtggtgtgaatccgttg
acgcataaacgcgttcttcaggccgacaacgtgccgtacattctggccgaaatgatgatg
gaagggctgtatggtcgctccggtgactgggcgtatcgtgttggtttaccgggcaaaagc
ggtgtaggtggcggtattctggcggtcgtccctggagtgatgggaattgccgcgttctca
ccaccgctggacgaagatggcaacagtgttcgcggtcaaaaaatggtggcatcggtcgct
aagcaactcggctataacgtgtttaagggctga

DBGET integrated database retrieval system