KEGG   Escherichia coli K-12 W3110: Y75_p0541Help
Entry
Y75_p0541         CDS       T00068                                 

Gene name
ybcS
Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ecj  Escherichia coli K-12 W3110
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
576836..577333
Genome map
AA seq 165 aa AA seqDB search
MPPSLRKAVAAAIGGGAIAIASVLITGPSGNDGLEGVSYIPYKDIVGVWTVCHGHTGKDI
MLGKTYTKAECKALLNKDLATVARQINPYIKVDIPETTRGALYSFVYNVGAGNFRTSTLL
RKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCLWGQQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatcattacgaaaagccgttgctgctgctattggtggcggagcaattgctata
gcatcagtgttaatcactggcccaagtggtaacgatggtctggaaggtgtcagctacata
ccatacaaagatattgttggtgtatggactgtatgtcacggacacaccggaaaagacatc
atgctcggtaaaacgtataccaaagcagaatgcaaagcactcttgaataaagaccttgcc
actgtcgccagacaaattaacccgtatatcaaagtcgatataccggaaacaacgcgcggc
gctctttactcattcgtttacaacgtgggtgctggcaattttagaacatcgacgcttctt
cgcaaaataaaccagggcgatatcaaaggcgcatgtgatcagctgcgtcgctggacatac
gctggcggtaagcaatggaaaggcctgatgactcgtcgtgagattgagcgtgaagtctgt
ttgtgggggcaacagtga

DBGET integrated database retrieval system