KEGG   Escherichia coli K-12 W3110: Y75_p2737Help
Entry
Y75_p2737         CDS       T00068                                 

Gene name
fucA
Definition
L-fuculose-1-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ecj00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Nara: 
Wisconsin: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2931697..2932344)
Genome map
AA seq 215 aa AA seqDB search
MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDG
NGKHEEGKLPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIPAIHYMIAAAGG
NSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVEVLAQL
YLTTLAITDPVPVLSDEEIAVVLEKFKTYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaaataaacttgctcgtcagattattgacacttgcctggaaatgacccgcctg
ggactgaaccaggggacagcggggaacgtcagtgtacgttatcaggatgggatgctgatt
acgcctacaggcattccatatgaaaaactgacggagtcgcatattgtctttattgatggc
aacggtaaacatgaggaaggaaagctcccctcaagcgaatggcgtttccatatggcagcc
tatcaaagcagaccggatgccaacgcggttgttcacaatcatgccgttcattgcacggca
gtttccattcttaaccgatcgatccccgctattcactacatgattgcggcggctggcggt
aattctattccttgcgcgccttatgcgacctttggaacacgcgaactttctgaacatgtt
gcgctggctctcaaaaatcgtaaggcaactttgttacaacatcatgggcttatcgcttgt
gaggtgaatctggaaaaagcgttatggctggcgcatgaagttgaagtgctggcgcaactt
tacctgacgaccctggcgattacggacccggtgccagtgctgagcgatgaagagattgcc
gtagtgctggagaaattcaaaacctatgggttacgaattgaagagtaa

DBGET integrated database retrieval system