KEGG   Escherichia coli K-12 W3110: Y75_p2833Help
Entry
Y75_p2833         CDS       T00068                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase A
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ecj00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Nara: 
Wisconsin: 
UniProt: 
Structure
PDB: 

Jmol
Position
3042318..3043757
Genome map
AA seq 479 aa AA seqDB search
MIVKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVLPGKY
YPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMFDE
LLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE
INNQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINPEMKVGC
MLAMVPLYPYSCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGD
LDVLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRY
ALCELYERYQRPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLM
GYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGEKL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgaaaaaactcaccttaccgaaagatttcttatggggcggcgcagttgccgct
catcaggtcgaaggcggctggaacaaaggcggaaaagggccgagcatttgtgacgttctg
accggtggcgcacacggcgtgccgcgcgaaatcaccaaagaagtcttgccaggaaaatac
tatccaaaccatgaagccgttgatttttatggtcactataaggaagacatcaagctattt
gccgaaatgggcttcaaatgttttcgtacatccattgcctggacgcgcatttttccaaaa
ggcgatgaagctcagccaaacgaagaagggctgaagttctacgatgatatgttcgatgaa
ctgctgaaatacaacatcgaaccggtgatcaccctctcccactttgaaatgccgctgcat
ctggtgcagcaatacggtagctggaccaaccgtaaagtggttgatttctttgtacgtttc
gcggaagtggtatttgaacgctataagcacaaagtcaaatactggatgaccttcaacgaa
attaacaaccagcgtaactggcgtgcaccgctgttcggttactgctgctccggcgtggtg
tataccgagcatgaaaacccggaagagacgatgtatcaggtgctgcatcaccagtttgtc
gccagcgccctggcggtgaaagctgcgcgtcgcattaacccggagatgaaagtcggctgt
atgctggcgatggtgccgctctatccttactcctgtaacccggacgatgtgatgttcgct
caggagtcgatgcgcgaacgctacgtctttaccgatgtgcagctacgcggctattacccg
tcctatgtgttgaacgagtgggagcgtcgcggatttaacatcaaaatggaagacggcgat
ctggatgtgctgcgtgaaggcacctgcgattatcttggtttcagctattacatgaccaat
gcagtgaaggccgaaggcggcaccggcgatgcgatctctggttttgaaggcagcgtacca
aacccgtatgttaaagcatctgactggggctggcagattgatccagtaggtctgcgctat
gcactttgcgaactgtatgagcgttatcagaggccgctgtttattgtcgaaaacggtttt
ggcgcttacgacaaagtggaagaagatggcagcatcaacgacgactaccgcattgactac
ctgcgcgcccatatcgaagagatgaaaaaagcggtgacttacgatggcgtggatctgatg
ggctacacaccgtggggctgcatcgactgcgtgtcgttcaccaccgggcagtacagcaaa
cgctacggctttatctatgtgaataaacatgacgacggtactggcgatatgtcgcgttca
cgtaagaagagctttaactggtacaaagaggtgattgccagcaacggcgagaagctttaa

DBGET integrated database retrieval system