KEGG   Escherichia coli K-12 W3110: Y75_p3610Help
Entry
Y75_p3610         CDS       T00068                                 

Gene name
xylA
Definition
D-xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecj00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Y75_p3610 (xylA)
   00051 Fructose and mannose metabolism
    Y75_p3610 (xylA)
Enzymes [BR:ecj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Y75_p3610 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Nara: 
Wisconsin: 
UniProt: 
Position
3909650..3910972
Genome map
AA seq 440 aa AA seqDB search
MQAYFDQLDRVRYEGSKSSNPLAFRHYNPDELVLGKRMEEHLRFAACYWHTFCWNGADMF
GVGAFNRPWQQPGEALALAKRKADVAFEFFHKLHVPFYCFHDVDVSPEGASLKEYINNFA
QMVDVLAGKQEESGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVTAMEATHKL
GGENYVLWGGREGYETLLNTDLRQEREQLGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTK
HQYDYDAATVYGFLKQFGLEKEIKLNIEANHATLAGHSFHHEIATAIALGLFGSVDANRG
DAQLGWDTDQFPNSVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALALKIAARMIEDGELDKRIAQRYSGWNSELGQQILKGQMSLADLAKYAQEHHLSPV
HQSGRQEQLENLVNHYLFDK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcctattttgaccagctcgatcgcgttcgttatgaaggctcaaaatcctcaaac
ccgttagcattccgtcactacaatcccgacgaactggtgttgggtaagcgtatggaagag
cacttgcgttttgccgcctgctactggcacaccttctgctggaacggggcggatatgttt
ggtgtgggggcgtttaatcgtccgtggcagcagcctggtgaggcactggcgttggcgaag
cgtaaagcagatgtcgcatttgagtttttccacaagttacatgtgccattttattgcttc
cacgatgtggatgtttcccctgagggcgcgtcgttaaaagagtacatcaataattttgcg
caaatggttgatgtcctggcaggcaagcaagaagagagcggcgtgaagctgctgtgggga
acggccaactgctttacaaaccctcgctacggcgcgggtgcggcgacgaacccagatcct
gaagtcttcagctgggcggcaacgcaagttgttacagcgatggaagcaacccataaattg
ggcggtgaaaactatgtcctgtggggcggtcgtgaaggttacgaaacgctgttaaatacc
gacttgcgtcaggagcgtgaacaactgggccgctttatgcagatggtggttgagcataaa
cataaaatcggtttccagggcacgttgcttatcgaaccgaaaccgcaagaaccgaccaaa
catcaatatgattacgatgccgcgacggtctatggcttcctgaaacagtttggtctggaa
aaagagattaaactgaacattgaagctaaccacgcgacgctggcaggtcactctttccat
catgaaatagccaccgccattgcgcttggcctgttcggttctgtcgacgccaaccgtggc
gatgcgcaactgggctgggacaccgaccagttcccgaacagtgtggaagagaatgcgctg
gtgatgtatgaaattctcaaagcaggcggtttcaccaccggtggtctgaacttcgatgcc
aaagtacgtcgtcaaagtactgataaatatgatctgttttacggtcatatcggcgcgatg
gatacgatggcactggcgctgaaaattgcagcgcgcatgattgaagatggcgagctggat
aaacgcatcgcgcagcgttattccggctggaatagcgaattgggccagcaaatcctgaaa
ggccaaatgtcactggcagatttagccaaatatgctcaggaacatcatttgtctccggtg
catcagagtggtcgccaggaacaactggaaaatctggtaaaccattatctgttcgacaaa
taa

DBGET integrated database retrieval system