KEGG   Escherichia coli 55989 (EAEC): EC55989_0498Help
Entry
EC55989_0498      CDS       T00826                                 

Gene name
ybaS
Definition
(GenBank) amidase, possibly glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck00220  Arginine biosynthesis
eck00250  Alanine, aspartate and glutamate metabolism
eck00471  D-Glutamine and D-glutamate metabolism
eck01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eck00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EC55989_0498 (ybaS)
   00220 Arginine biosynthesis
    EC55989_0498 (ybaS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    EC55989_0498 (ybaS)
Enzymes [BR:eck01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     EC55989_0498 (ybaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: CAU96371
UniProt: B7L7B0
Structure
PDB: 

Jmol
Position
538750..539682
Genome map
AA seq 310 aa AA seqDB search
MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDGKVYSAGDSDY
RFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGA
IATTSLINAENVEQRWQRILHIQQQLAGEQVALSDEVNQSEQTTNFHNRAIAWLLYSAGY
LYCDAMEACDVYTRQCSTLLNTVELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMM
EGLYGRSGEWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEEGNSVRGQKMVASVA
KQLGYNVFKG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaacaaattacagcaggcagtggatcaggcttacacccaatttcactca
cttaacggcggtcaaaatgccgactacattccctttctggcgaatgtgcctggtcaactg
gcggcagtggctatcgtgacctgcgatggcaaggtctatagtgcgggtgacagtgattac
cgctttgcgctggaatccatctcgaaagtctgtacgttagcccttgcgttagaggatgtc
ggcccgcaggcggtacaggacaaaattggcgctgacccgaccggattgccctttaactca
gttatcgccttagagttgcatggcggcaaaccgctttcgccactggtaaatgctggcgcc
attgccaccaccagcctgattaacgctgaaaatgttgaacaacgctggcagcgaatttta
catatccaacagcaactggctggtgagcaggtagcgctctctgacgaagtcaaccagtcg
gaacaaacaaccaacttccataaccgggccattgcctggctgctgtactccgccggatat
ctctattgtgatgcaatggaagcctgtgacgtgtacacccgtcagtgctccacgctcctc
aatactgttgaactggcaacacttggcgcgacgctggcggcggggggagtgaatccgctg
acgcataaacgcgttcttcaggccgataacgtgccgtacattctggccgaaatgatgatg
gaagggctgtatggtcgctccggtgagtgggcatatcgcgttggtttaccgggcaaaagc
ggtgtaggtggcggtattctggcggtcgtccctggtgtgatgggaattgccgcgttctca
ccaccgctggacgaagaaggcaacagtgttcgcggtcaaaaaatggtggcatcggtcgct
aagcaactcggctataacgtgtttaagggctga

DBGET integrated database retrieval system