KEGG   Escherichia coli 55989 (EAEC): EC55989_0706Help
Entry
EC55989_0706      CDS       T00826                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, membrane subunit, binds cytochrome b556
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck00020  Citrate cycle (TCA cycle)
eck00190  Oxidative phosphorylation
eck00650  Butanoate metabolism
eck01100  Metabolic pathways
eck01110  Biosynthesis of secondary metabolites
eck01120  Microbial metabolism in diverse environments
eck01130  Biosynthesis of antibiotics
eck01200  Carbon metabolism
Module
eck_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eck_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eck_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eck00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EC55989_0706 (sdhD)
   00650 Butanoate metabolism
    EC55989_0706 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    EC55989_0706 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CAU96576
UniProt: B7LAC9
Structure
PDB: 

Jmol
Position
769923..770270
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVVFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcgtttttttcgccaccagt
ggcgaactgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgattcatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggcattgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system