KEGG   Escherichia coli 55989 (EAEC): EC55989_1420Help
Entry
EC55989_1420      CDS       T00826                                 

Gene name
trpC
Definition
(GenBank) fused indole-3-glycerolphosphate synthetase; N-(5-phosphoribosyl)anthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eck01100  Metabolic pathways
eck01110  Biosynthesis of secondary metabolites
eck01130  Biosynthesis of antibiotics
eck01230  Biosynthesis of amino acids
Module
eck_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eck00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EC55989_1420 (trpC)
Enzymes [BR:eck01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     EC55989_1420 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     EC55989_1420 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CAU97277
UniProt: B7L494
Structure
PDB: 

Jmol
Position
complement(1462191..1463549)
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVETRKQQQPLASFQNEVQPSTRHFYDALQGARTAFILECKKASPS
KGVIRDDFDPARIAAIYKHYASAISVLTDEKYFQGSFDFLPIVSQIAPQPILCKDFIIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLAAVAHSLEMGVLTEVSNEEELERAIALGAKV
VGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVRELSHFANGFLIGSALM
AHDDLHAAVRRVLLGENKVCGLTRGQDAKAAYDAGAIYGGLIFVATSPRCVNVEQAQEVM
AAAPLQYVGVFRNHDIADVVDKAKVLSLAAVQLHGNEEQLYIDTLREALPAHVAIWKALS
VGETLPAREFQHVDKYVLDNGQGGSGQRFDWSLLNGQSLGNVLLAGGLGADNCVEAAQTG
CAGLDFNSAVESQPGIKDARLLASVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaaacccgcaaa
cagcagcaaccgctggccagttttcagaatgaggttcagccgagcacgcgacatttttat
gatgcgctacagggtgcacgcacggcgtttattctggagtgcaagaaagcgtcgccgtca
aaaggcgtgatccgtgatgatttcgatccagcacgcattgccgccatttataaacattac
gcttcggcaatttcggtgctgactgatgagaaatattttcaggggagctttgatttcctc
cccatcgtcagccaaatcgccccgcagccgattttatgtaaagacttcattatcgatcct
taccagatctatctggcgcgctattaccaggccgatgcctgcttattaatgctttcagta
ctggatgacgaacaatatcgccagcttgccgccgtcgcccacagtctggagatgggtgtg
ctgaccgaagtcagtaatgaagaggaactggagcgtgccattgcattgggggcaaaggtc
gttggcatcaacaaccgcgatctgcgtgatttgtcgattgatctcaaccgtacccgcgag
cttgcgccgaaactggggcacaacgtgacggtaatcagcgaatccggcatcaatacttac
gctcaggtgcgcgagttaagccacttcgctaacggttttctgattggttcggcgttgatg
gcccatgacgatttgcacgccgccgtgcgccgggtgttgctgggtgagaataaagtatgt
ggcctgacgcgtgggcaagatgctaaagcagcttatgacgcgggcgcgatttacggtggg
ttgatttttgttgcgacatcaccgcgttgcgtcaacgttgaacaggcgcaggaagtgatg
gctgcggcaccgttgcagtatgttggcgtgttccgcaatcacgatattgccgatgtggtg
gacaaagctaaggtgttatcgctggcggcagtgcaactgcatggtaatgaagaacagctg
tatatcgatacgctgcgtgaagctctgccagcacatgttgccatctggaaagcattaagc
gtcggtgaaaccctgcccgcccgcgagtttcagcacgttgataaatatgttttagacaac
ggccagggtggaagcgggcaacgttttgactggtcactattaaatggtcaatcgcttggc
aacgttctgctggcggggggcttaggcgcagataactgcgtggaagcggcacaaaccggc
tgcgccggacttgattttaattctgctgtagagtcgcaaccgggcatcaaagacgcacgt
cttttggcctcggttttccagacgctgcgcgcatattaa

DBGET integrated database retrieval system