KEGG   Escherichia coli 55989 (EAEC): EC55989_1529Help
Entry
EC55989_1529      CDS       T00826                                 

Gene name
paaF
Definition
(GenBank) enoyl-CoA hydratase-isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck00071  Fatty acid degradation
eck00280  Valine, leucine and isoleucine degradation
eck00281  Geraniol degradation
eck00310  Lysine degradation
eck00360  Phenylalanine metabolism
eck00362  Benzoate degradation
eck00380  Tryptophan metabolism
eck00410  beta-Alanine metabolism
eck00627  Aminobenzoate degradation
eck00640  Propanoate metabolism
eck00650  Butanoate metabolism
eck00903  Limonene and pinene degradation
eck00930  Caprolactam degradation
eck01100  Metabolic pathways
eck01110  Biosynthesis of secondary metabolites
eck01120  Microbial metabolism in diverse environments
eck01130  Biosynthesis of antibiotics
eck01212  Fatty acid metabolism
Module
eck_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eck00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EC55989_1529 (paaF)
   00650 Butanoate metabolism
    EC55989_1529 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    EC55989_1529 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EC55989_1529 (paaF)
   00310 Lysine degradation
    EC55989_1529 (paaF)
   00360 Phenylalanine metabolism
    EC55989_1529 (paaF)
   00380 Tryptophan metabolism
    EC55989_1529 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EC55989_1529 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EC55989_1529 (paaF)
   00281 Geraniol degradation
    EC55989_1529 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EC55989_1529 (paaF)
   00627 Aminobenzoate degradation
    EC55989_1529 (paaF)
   00930 Caprolactam degradation
    EC55989_1529 (paaF)
Enzymes [BR:eck01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EC55989_1529 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CAU97386
UniProt: B7L6B3
Structure
PDB: 

Jmol
Position
1574962..1575729
Genome map
AA seq 255 aa AA seqDB search
MSELIVSRQQRVLLLTLNRPAARNALNNALLMQLVNELEAAATDTSISVCVITGNARFFA
AGADLNEMAEKDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAG
ENARFGLPEITLGIIPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPS
DLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEG
ISAFLQKRSPDFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgatcgtcagccgtcagcaacgagtattgttgctgacccttaaccgtccc
gccgcacgtaatgcgctaaataatgccctgctgatgcaactggtaaatgaactggaagct
gcggctaccgataccagcatttcggtctgtgtgattaccggtaatgcacgcttttttgcc
gctggggccgatctcaacgaaatggcagaaaaagatctcgcggccaccttaaacgataca
cgtccgcagctatgggcgcgattgcaggcctttaataaaccacttatcgcagccgtcaat
ggttacgcgcttggggcgggttgcgaactggcattgttgtgcgatgtggtggttgccgga
gagaacgcgcgttttgggttgccggaaatcactctcggcatcatacctggcgcaggcgga
acgcaacgtttaatccgtagtgtcggtaaatcgttagccagcaaaatggtgctgagcgga
gaaagtatcaccgctcagcaagcacagcaggccgggctggttagcgacgtcttccccagc
gatttaaccctcgaatacgccttacagctggcatcgaaaatggcacgtcactcgccgctg
gccttacaagcggcaaagcaagcgctgcgccagtcgcaggaagtggctttgcaagccgga
cttgcccaggagcgacagttattcaccttgctggcggcaacagaagatcgtcatgaaggc
atctctgctttcttacaaaaacgctcgcctgactttaaaggacgctaa

DBGET integrated database retrieval system