KEGG   Escherichia coli 55989 (EAEC): EC55989_1574Help
Entry
EC55989_1574      CDS       T00826                                 

Gene name
ydcU
Definition
(GenBank) putative spermidine/putrescine transporter subunit; permease of ABC superfamily transporter
  KO
K02054  
putative spermidine/putrescine transport system permease protein
Organism
eck  Escherichia coli 55989 (EAEC)
Module
Putative spermidine/putrescine transport system
Brite
Transporters [BR:eck02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putative spermidine/putrescine transporter [MD:M00193]
    EC55989_1574 (ydcU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1622339..1623280
Genome map
AA seq 313 aa AA seqDB search
MAMNVLQSPSRPGLGKVSGFFWRNPGLGLFLLLLGPLMWFGIVYFGSLLTLLWQGFYTFD
DFTMSVTPELTLANIRALFNPANYDIILRTLTMAVAVTIASAILAFPMAWYMARYTSGKM
KAFFYIAVMLPMWASYIVKAYAWTLLLAKDGVAQWFLQHLGLEPLLTAFLTLPAVGGNTL
STSGLGRFLVFLYIWLPFMILPVQAALERLPPSLLQASADLGARPRQTFRYVVLPLAIPG
IAAGSIFTFSLTLGDFIVPQLVGPPGYFIGNMVYSQQGAIGNMPMAAAFTLVPIVLIALY
LAFVKRLGAFDAL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaatgtattgcaatcaccttcacgtccaggtctgggtaaggtgtccggtttc
ttctggcgtaatccggggctggggctgtttttactgctgcttggcccgctaatgtggttt
ggcattgtctatttcggctcgctgctgacactgttatggcagggattttatacttttgac
gatttcaccatgtcggtaacgccggaactgacgctggcgaatatccgtgcgctgtttaat
ccggcgaattacgacatcattctccgcacgctgactatggctgtggcagtcactatcgcc
agcgccattctggcttttccaatggcgtggtatatggcgcgctataccagcgggaaaatg
aaagcttttttttatattgcggtaatgttgccgatgtgggcgagctacattgttaaagcc
tatgcctggacgttattgctggcaaaagatggcgtggctcagtggtttttacaacatctt
gggctggaaccactgctgactgcgttccttacattacctgcggtgggcggaaatacgctg
tcaacttccgggctggggcgctttctggtgtttctctatatctggttgccgttcatgatc
ctgcccgttcaggcggcgcttgagcgtttgccgccgtcattgttgcaggcgtcggctgat
ctcggcgcacgtccacgacaaacctttcgctatgtggtgctgccgctggcaatcccgggt
attgccgctggctctatctttaccttctcactcacactgggcgattttatcgtcccgcag
ctggttggtcctccaggatattttatcggcaatatggtttattcccagcagggggcgatt
ggcaatatgccgatggcggcggcattcaccctggtgccgattgttctcatcgcactgtac
ctggcgttcgtgaaacgtctgggagcgttcgatgcactctga

DBGET integrated database retrieval system