KEGG   Escherichia coli 55989 (EAEC): EC55989_1610Help
Entry
EC55989_1610      CDS       T00826                                 

Gene name
adhP
Definition
(GenBank) alcohol dehydrogenase, 1-propanol preferring
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck00010  Glycolysis / Gluconeogenesis
eck00071  Fatty acid degradation
eck00350  Tyrosine metabolism
eck00625  Chloroalkane and chloroalkene degradation
eck00626  Naphthalene degradation
eck01100  Metabolic pathways
eck01110  Biosynthesis of secondary metabolites
eck01120  Microbial metabolism in diverse environments
eck01130  Biosynthesis of antibiotics
eck01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eck00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EC55989_1610 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    EC55989_1610 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    EC55989_1610 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EC55989_1610 (adhP)
   00626 Naphthalene degradation
    EC55989_1610 (adhP)
Enzymes [BR:eck01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EC55989_1610 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 2-Hacid_dh_C Methyltransf_31 Phage_holin_2_1
Motif
Other DBs
NCBI-ProteinID: CAU97464
UniProt: B7L7H8
Structure
PDB: 

Jmol
Position
complement(1665189..1666199)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMAEE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagttgttacgaaggatcatcacgttgacgttacggataaaacactgcgc
tcactgaaacatggcgaagccctgctgaaaatggagtgttgtggtgtatgtcataccgat
cttcatgttaagaatggcgattttggtgacaaaactggcgtaattctgggccatgaaggc
atcggtgtggtggcagaagttggccctggtgtcacctcattaaaaccaggcgatcgtgcc
agcgtggcgtggttctacgaaggatgcggtcattgcgaatactgtaatagtggtaacgaa
acgctctgccgttcagttaaaaatgccggatacagcgttgatggcgggatggcggaagag
tgcatcgtggtcgccgattacgcggtaaaagtgccagatggtctggactcggcggcggcc
agcagcattacctgtgcgggggtcaccacctacaaagccgttaaactgtcaaaaattcgt
ccagggcagtggattgctatctacggtcttggcggtctgggtaacctcgctctgcaatac
gcgaagaatgtctttaacgcgaaagtgatcgccattgatgtcaatgatgagcagttaaaa
ctggcaaccgaaatgggtgcagatttagcgattaactcacgcaccgaagacgccgccaaa
attgtgcaggagaaaaccggtggcgctcacgctgcggtggtaacagcagttgctaaagct
gcgtttaactcggcagttgatgctgtccgtgcaggcggtcgtgttgtggctgtcggtctg
ccgccggagtctatgagcctggatatcccacgccttgtgctggatggcattgaagtggtc
ggttcgctggtcggcacgcgccaggatctaaccgaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcgccctgcgtccgttagcggacatcaacaccatctttaccgag
atggaagaaggcaaaatccgtggccgtatggtgattgatttccgccgttaa

DBGET integrated database retrieval system