KEGG   Escherichia coli 55989 (EAEC): EC55989_1657Help
Entry
EC55989_1657      CDS       T00826                                 

Gene name
yneH
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:eck00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:eck00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:eck00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1728457..1729383)
Genome map
AA seq 308 aa AA seqDB search
MAVAMDNAILENILRQVRPLIGQGKVADYIPALATVDGSRLGIAICTVDGQLFQAGDAQE
RFSIQSISKVLSLVVAMRHYSEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGA
LVVCDMLQGRLSAPRQRMLEVVRGLSGVSDISYDTVVARSEFEHSARNAAIAWLMKSFGN
FHHDVTTVLQNYFHYCALKMSCVELARTFVFLANQGKAIHIDEPVVTPMQARQINALMAT
SGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDDAGNSLAGIAVLEQLT
KQLGRSVY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtcgccatggataatgcaattttagaaaacatcttgcggcaagtgcggccgctc
attggtcagggtaaagtcgcggattatattccggcgctggctacagtagacggttcccga
ttgggcattgctatctgtaccgttgacggacagctttttcaggccggagacgcgcaagaa
cgtttttccattcagtctatttccaaagtgctgagtctcgttgtcgccatgcgtcattac
tccgaagaggaaatctggcaacgcgtcggcaaagatccgtctggatcaccgttcaattct
ttagtgcaactggaaatggagcagggtattccgcgtaatccgtttattaatgctggtgcg
ctggtggtttgcgatatgttgcaagggcgattaagcgcaccacggcaacgtatgctggaa
gtcgtgcgcggcttaagcggtgtgtctgatatttcatacgatacggtggtagcgcgttcc
gaatttgaacattccgcgcgaaatgcggctatcgcctggctgatgaagtcgtttggcaat
ttccatcatgatgtgacaaccgttctgcaaaactactttcattactgcgctctgaaaatg
agctgtgtagagctggcccggacgtttgtctttctggctaatcaggggaaagctattcat
attgatgaacctgtggtgacgccaatgcaggcgcggcaaattaacgcgctgatggcgacc
agtggtatgtaccagaacgcgggggagtttgcctggcgggtggggctaccggcgaaatct
ggcgttggtggcggtattgtggcgattgttccgcatgaaatggccatcgctgtctggagt
ccggaactggatgatgcaggtaactcgcttgcgggtattgccgtccttgaacaattgacg
aaacagttagggcgttcggtttattaa

DBGET integrated database retrieval system