KEGG   Escherichia coli 55989 (EAEC): EC55989_2297Help
Entry
EC55989_2297      CDS       T00826                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eck00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EC55989_2297 (galF)
   00052 Galactose metabolism
    EC55989_2297 (galF)
   00500 Starch and sucrose metabolism
    EC55989_2297 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    EC55989_2297 (galF)
Enzymes [BR:eck01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EC55989_2297 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2342353..2343246)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttataccggtagcgggtcttgggatgcatatgttgcctgcc
actaaggcgatacccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcatgcgtccaag
aacgcggtcgaaaaccactttgacacctcttatgaattagaatctctccttgaacagcgt
gtgaagcgtcagctgctggcggaagtgcagtcgatctgcccgccgggcgtaaccattatg
aacgtgcgtcagggcgaacctttaggtttgggccactccattttatgtgcacgacccgcc
attggtgacaacccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagcgcc
gacccgctgcgctacaaccttgcagccatgattgcgcgcttcaacgaaacgggacgcagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactccgtcatccagaccaaa
gagccgctggatcgtgaaggcaaagtcagccgcattgttgaatttatcgaaaaacctgat
cagccgcagacgctggactcagacatcatggccgttggtcgctatgtgctttctgccgat
atttggccggaacttgaacgcacgcagcctggtgcgtggggacgtattcagctgactgat
gctattgccgaactggcgaaaaaacaatctgttgatgcaatgctgatgacaggtgatagc
tacgactgcggtaaaaaaatgggttatatgcaggcgtttgtgaagtatggactacgcaac
ctgaaagaaggggcgaagttccgtaaaggcattgagaagctgttaagcgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system