KEGG   Escherichia coli 55989 (EAEC): EC55989_2460Help
Entry
EC55989_2460      CDS       T00826                                 

Gene name
napA
Definition
(GenBank) nitrate reductase, periplasmic, large subunit
  KO
K02567  
periplasmic nitrate reductase NapA [EC:1.7.99.-]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:eck00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    EC55989_2460 (napA)
Enzymes [BR:eck01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     EC55989_2460 (napA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2514293..2516779)
Genome map
AA seq 828 aa AA seqDB search
MKLSRRSFMKANAVAAAAAAAGLSVPGVARAVVGQQEAIKWDKAPCRFCGTGCGVLVGTQ
QGRVVACQGDPDAPVNRGLNCIKGYFLPKIMYGKDRLTQPLLRMKNGKYDKEGEFTPITW
DQAFDVMEEKFKTALKEKGPESIGMFGSGQWTIWEGYAASKLFKAGFRSNNIDPNARHCM
ASAVVGFMRTFGMDEPMGCYDDIEQADAFVLWGANMAEMHPILWSRITNRRLSNQNVTVA
VLSTYQHRSFELADNGIIFTPQSDLVILNYIANYIIQNNAINQDFFSKHVNLRKGATDIG
YGLRPTHPLEKAAKNPGSDASEPMSFEDYKAFVAEYTLEKTAEMTGVPKDQLEQLAQLYA
DPNKKVISYWTMGFNQHTRGVWANNLVYNLHLLTGKISQPGCGPFSLTGQPSACGTAREV
GTFAHRLPADMVVTNEKHRDICEKKWNIPGGTIPAKIGLHAVAQDRALKDGKLNVYWTMC
TNNMQAGPNINEERMPGWRDPRNFIIVSDPYPTVSALAADLILPTAMWVEKEGAYGNAER
RTQFWRQQVQAPGEAKSDLWQLVQFSRRFKTEEVWPEELLAKKPELRGKTLYEVLYATPE
VSKFPVSELAEDQLNDESRELGFYLQKGLFEEYAWFGRGHGHDLAPFDDYHKARGLRWPV
VNGKETQWRYSEGNDPYVKAGEGYKFYGKPDGKAVIFALPFEPAAEAPDEEYDLWLSTGR
VLEHWHTGSMTRRVPELHRAFPEAVLFIHPLDAKARDLRRGDKVKVVSRRGEVISIVETR
GRNRPPQGLVYMPFFDAAQLVNKLTLDATDPLSKETDFKKCAVKLEKV
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcagtcgtcgtagctttatgaaagctaacgccgttgcggccgctgcggcggct
gccggtctcagcgtgccgggcgttgcccgcgccgttgttggtcagcaggaagccattaaa
tgggataaagcgccgtgccgtttctgcggtactggttgcggcgttctggtcggaacgcag
caggggcgtgtggtggcctgtcagggcgacccggacgcaccggttaaccgtggcctgaac
tgcattaagggctatttcctgcccaagatcatgtacggtaaagaccgtttgacgcagccg
ctgctgcgtatgaaaaacggtaaatatgacaaagaaggcgaatttaccccaatcacctgg
gatcaggccttcgatgtgatggaagagaaattcaaaaccgccctgaaagaaaaaggaccg
gaatcgatcggtatgttcggttctggtcagtggactatctgggaaggttatgccgcgtcc
aagctgttcaaagcgggcttccgttcgaacaacatcgacccgaacgcacgtcactgtatg
gcgtcggcagtagttggctttatgcgtacctttggtatggatgagccgatgggctgctat
gacgacatcgagcaggctgacgcgtttgtgctgtggggcgctaacatggcggagatgcac
ccgatcctctggtcacgcatcactaaccgtcgtctctctaaccagaacgtcaccgtggcg
gtgctttctacctaccagcatcgtagcttcgagctggcggataacggcatcatctttacg
ccgcaatctgacctggtgatcctgaactacatcgccaactatatcattcaaaacaatgcg
ataaatcaggacttcttcagcaagcacgttaacctgcgcaaaggggcgacggacatcggc
tacggtttacgtccgacccatccgctggaaaaagcagcgaagaatccgggttctgacgcc
tccgaaccgatgagctttgaagattacaaagccttcgttgctgagtatacgctggaaaaa
accgctgaaatgaccggcgtgccgaaagaccagttagaacaactggcgcagctgtatgcc
gatccgaacaagaaagtcatctcctactggacgatgggcttcaaccagcatacccgtggt
gtgtgggccaacaacctggtctacaacctgcacctgctgaccggcaaaatttcccagccg
ggttgcggtccgttctccctgaccgggcagccttctgcgtgtggtactgcgcgtgaagtg
ggcacctttgctcaccgtctgcctgcggacatggtggtgactaacgagaaacatcgtgat
atctgcgagaagaagtggaatatcccgggcggcaccattccggcaaaaatcggtctgcac
gcggtggcacaagaccgtgcgctgaaagacggcaagctgaatgtttactggaccatgtgt
accaacaacatgcaggccgggccgaacatcaatgaagagcgtatgccgggctggcgcgat
ccgcgcaacttcatcatcgtctccgatccgtatccgacagtcagtgcgctggccgccgac
ttgatcctgccgaccgcaatgtgggtagagaaagagggcgcttacggtaacgccgaacgc
cgtactcagttctggcgtcagcaggtacaggcgccaggcgaagcgaaatcggatctctgg
cagttagtccagttctcccgccgcttcaaaactgaagaagtatggccggaagagctgctg
gcgaagaaaccggaactgcgtggcaaaacgctgtacgaagttctgtatgccacccccgaa
gtgagcaaattcccggtatccgaactggcggaagatcagctgaacgatgaatcccgcgag
ctgggcttctatctgcaaaaagggctgttcgaagagtacgcatggtttggtcgcggtcac
ggtcacgatctcgcgccgttcgatgactaccacaaagcgcgcggtctgcgctggccggtg
gtgaacggtaaagaaacacagtggcgttacagcgaaggtaacgacccgtacgtgaaagcg
ggcgaaggctataagttctacggtaaaccggatggcaaagcggtgatcttcgcactgccg
ttcgaaccggcggcggaagcaccggatgaagagtacgacctgtggctctctaccggacgc
gttctggagcactggcacaccggcagtatgactcgccgtgtgccggaactgcaccgcgcc
ttcccggaagcggtcttgtttattcacccgctggatgcgaaagcgcgcgatctgcgccgt
ggcgacaaagtgaaagtggtttctcgccgtggcgaagtgatctcgattgttgaaacgcgc
ggtcgtaaccgtccgccacagggcctggtgtacatgccgttcttcgacgccgcacagctg
gttaacaaactgacgctggatgcgaccgatccgctctcgaaagagacggacttcaagaag
tgcgcagtcaaactggagaaggtgtaa

DBGET integrated database retrieval system