KEGG   Escherichia coli 55989 (EAEC): EC55989_2620Help
Entry
EC55989_2620      CDS       T00826                                 

Gene name
ybcS
Definition
lysozyme; DLP12 prophage
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eck  Escherichia coli 55989 (EAEC)
Brite
Enzymes [BR:eck01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     EC55989_2620 (ybcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2690407..2690904)
Genome map
AA seq 165 aa AA seqDB search
MSPALRNSVIAAISGGAIAIASVLITGPSGNDGLEGVSYIPYKDIVGVWTVCHGHTGKDI
MLGKTYTEAECKALLNKDLATVARQINPYIKVDIPETTRGALYSFVYNVGAGNFRTSTLL
RKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCLWGQQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccggcactacgaaatagcgtaatagcggcgataagtggcggggctattgctata
gcatctgtgttaatcactggaccaagtggtaacgatggcctggaaggtgtcagctacata
ccatacaaagatattgttggtgtatggactgtatgccacggacacaccggaaaagacatc
atgctcggtaaaacgtataccgaagcagaatgcaaagccctcctgaataaagaccttgcc
acggtcgccagacaaattaacccgtacatcaaagtcgatataccggaaacaacgcgcggc
gctctttattcgttcgtctataacgtgggcgcaggcaatttcagaacatcgacgcttctt
cgcaaaatcaaccagggcgatatcaagggcgcatgtgaccagctacgtcgctggacatac
gctggcggtaagcaatggaaagggctgatgactcgccgtgagattgagcgtgaagtctgt
ttgtgggggcagcaatga

DBGET integrated database retrieval system