KEGG   Escherichia coli 55989 (EAEC): EC55989_3121Help
Entry
EC55989_3121      CDS       T00826                                 

Gene name
yqeF
Definition
acetyl-CoA acetyltransferase (EC:2.3.1.9)
Orthology
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Two-component system
Class
Metabolism; Overview; Carbon metabolism [PATH:eck01200]
Metabolism; Overview; Fatty acid metabolism [PATH:eck01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:eck00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:eck00630]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:eck00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:eck00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:eck00071]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:eck00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:eck00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:eck00380]
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:eck00900]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:eck00362]
Environmental Information Processing; Signal transduction; Two-component system [PATH:eck02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3201563..3202744)
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGALRTPIGCFRGALAGRSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAG
AGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYAL
SSQQKARAAIDAGRFKDEIVPVMTQSNGQTLVVDTDEQPRTDASAEGLARLNPSFDSLGS
VTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRNARKGLATLCIGGGQGVALTIERDE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgttgtgattgtcggggcgttacggacacctatcggctgctttcgcggtgcg
ttagcgggtcgttccgccgtggaacttggtagtctggtcgtgaaagcgttaatagaacgt
accggcgttcctgcatatgcggtggatgaagtaattcttggtcaggtgttgactgcaggg
gcagggcagaatccggcaaggcaatcggctattaaaggtggtctgcctaatagcgtttct
gcaatcacgattaatgacgtctgcggttccggacttaaagcactgcatctggctactcag
gcgatacagtgtggcgaggctgatattgtcatcgccggtggccaggaaaacatgagccgc
gcaccacatgttctgactgatagccgcaccggtgcacagcttggcaatagccagctggtt
gacagtcttgtgcatgatgggttatgggatgccttcaatgattatcatattggtgtcacc
gccgaaaatctggctcgcgaatatggcatcagccgtcaattgcaggatgcttacgcactt
agctcgcaacaaaaagcgcgagcggcgattgacgccggacgatttaaagatgagatcgtc
ccggtaatgacccaaagtaacggtcagacgttggttgttgataccgatgaacagccacgc
actgacgccagtgcagaaggtttagcccgtttaaatccttcatttgatagtctcggttct
gtgacagcgggtaatgcatcatccataaacgatggcgcagctgcggtaatgatgatgagc
gaagccaaagcacgagcgttgaatttacccgtgctggcccgcattcgcgcatttgccagc
gttggtgtagatccggcattgatgggaattgcgccggtgtatgcgacccgccgttgcctg
gagcgtgtaggctggcagttggctgatgtcgatcttatcgaggctaatgaagcgtttgct
gcacaggcgctttcggttggcaagatgcttgagtgggatgagcgtcgggtcaatgtcaat
ggtggtgcgatcgcacttggtcacccgataggcgcttccggttgccgaatcctggtttct
ctggttcatgaaatggtgaaacgtaatgcccgcaaaggactggcaacgctttgtatcggc
gggggccagggtgtggcattgaccattgaacgtgacgaatag

DBGET integrated database retrieval system