KEGG   Escherichia coli 55989 (EAEC): EC55989_3121Help
Entry
EC55989_3121      CDS       T00826                                 

Gene name
yqeF
Definition
acetyl-CoA acetyltransferase (EC:2.3.1.9)
Orthology
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:eck00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EC55989_3121 (yqeF)
   01212 Fatty acid metabolism
    EC55989_3121 (yqeF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EC55989_3121 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    EC55989_3121 (yqeF)
   00640 Propanoate metabolism
    EC55989_3121 (yqeF)
   00650 Butanoate metabolism
    EC55989_3121 (yqeF)
  Lipid metabolism
   00071 Fatty acid degradation
    EC55989_3121 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    EC55989_3121 (yqeF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EC55989_3121 (yqeF)
   00310 Lysine degradation
    EC55989_3121 (yqeF)
   00380 Tryptophan metabolism
    EC55989_3121 (yqeF)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EC55989_3121 (yqeF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EC55989_3121 (yqeF)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    EC55989_3121 (yqeF)
Enzymes [BR:eck01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EC55989_3121 (yqeF)
Exosome [BR:eck04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EC55989_3121 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3201563..3202744)
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGALRTPIGCFRGALAGRSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAG
AGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYAL
SSQQKARAAIDAGRFKDEIVPVMTQSNGQTLVVDTDEQPRTDASAEGLARLNPSFDSLGS
VTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRNARKGLATLCIGGGQGVALTIERDE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgttgtgattgtcggggcgttacggacacctatcggctgctttcgcggtgcg
ttagcgggtcgttccgccgtggaacttggtagtctggtcgtgaaagcgttaatagaacgt
accggcgttcctgcatatgcggtggatgaagtaattcttggtcaggtgttgactgcaggg
gcagggcagaatccggcaaggcaatcggctattaaaggtggtctgcctaatagcgtttct
gcaatcacgattaatgacgtctgcggttccggacttaaagcactgcatctggctactcag
gcgatacagtgtggcgaggctgatattgtcatcgccggtggccaggaaaacatgagccgc
gcaccacatgttctgactgatagccgcaccggtgcacagcttggcaatagccagctggtt
gacagtcttgtgcatgatgggttatgggatgccttcaatgattatcatattggtgtcacc
gccgaaaatctggctcgcgaatatggcatcagccgtcaattgcaggatgcttacgcactt
agctcgcaacaaaaagcgcgagcggcgattgacgccggacgatttaaagatgagatcgtc
ccggtaatgacccaaagtaacggtcagacgttggttgttgataccgatgaacagccacgc
actgacgccagtgcagaaggtttagcccgtttaaatccttcatttgatagtctcggttct
gtgacagcgggtaatgcatcatccataaacgatggcgcagctgcggtaatgatgatgagc
gaagccaaagcacgagcgttgaatttacccgtgctggcccgcattcgcgcatttgccagc
gttggtgtagatccggcattgatgggaattgcgccggtgtatgcgacccgccgttgcctg
gagcgtgtaggctggcagttggctgatgtcgatcttatcgaggctaatgaagcgtttgct
gcacaggcgctttcggttggcaagatgcttgagtgggatgagcgtcgggtcaatgtcaat
ggtggtgcgatcgcacttggtcacccgataggcgcttccggttgccgaatcctggtttct
ctggttcatgaaatggtgaaacgtaatgcccgcaaaggactggcaacgctttgtatcggc
gggggccagggtgtggcattgaccattgaacgtgacgaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system