KEGG   Escherichia coli 55989 (EAEC): EC55989_3774Help
Entry
EC55989_3774      CDS       T00826                                 

Gene name
cysG
Definition
siroheme synthase (EC:2.1.1.107)
Orthology
K02302  
uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:eck00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3832361..3833734
Genome map
AA seq 457 aa AA seqDB search
MDHLPIFCQLRDRDCLIVGGGDVAERKARLLLDAGARLTVNALAFIPQFTAWADAGMLTL
VEGPFDESLLDTCWLAIAATDDDALNQRVSEAAEARRIFCNVVDAPKAASFIMPSIIDRS
PLMVAVSSGGTSPVLARLLREKLESLLPLHLGQVAKYAGQLRGRVKQQFATMGERRRFWE
KLFVNDRLAQSLANNDQKAITETTEQLINEPLDHRGEVVLVGAGPGDAGLLTLKGLQQIQ
QADVVVYDRLVSDDIMNLVRRDADRVFVGKRAGYHCVPQEEINQILLREAQKGKRVVRLK
GGDPFIFGRGGEELETLCNAGIPFSVVPGITAASGCSAYSGIPLTHRDYAQSVRLITGHL
KTGGELDWENLAAEKQTLVFYMGLNQAATIQQKLIEHGMPGEMPVAIVENGTAVTQRVID
GTLTQLGELAQQMNSPSLIIIGRVVGLRDKLNWFSNH
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtggatcatttgcctatattttgccaattacgcgatcgcgactgtctgattgtcggcggt
ggtgatgtcgcggaacgcaaagcaaggttgctgttagacgcaggcgctcgcttaacggtg
aatgcattagcgtttattccacagttcaccgcatgggcagatgcaggcatgttaaccctc
gtcgaagggccatttgatgaaagccttctcgacacctgctggctggcgattgcagcgacg
gatgatgacgcgcttaaccagcgcgtcagcgaagccgctgaagctcgtcgcatcttctgt
aacgtggtcgatgcgccgaaagctgccagcttcattatgccgtcgattattgaccgctca
ccgctgatggtggcggtttcctctggcggtacttctccggttctggcgcgcctgttgcgc
gaaaaactcgaatcactgctgccgctgcatctgggccaggtagcgaaatacgccgggcag
ttacgcggtcgggtaaaacaacagttcgccacgatgggtgaacgccgccgcttctgggaa
aaactgttcgttaacgaccgtctggcgcagtcgctggcgaacaacgatcagaaagccatt
actgaaaccaccgaacagttaatcaacgaaccgctcgaccatcgcggtgaagtggtgctg
gttggtgcaggtccgggcgatgccgggctgctgacactgaaaggtctgcaacaaattcag
caggcagatgtggtggtctacgaccgtctggtttctgacgatattatgaatctggtacgc
cgcgatgcggatcgtgttttcgtcggcaaacgcgcgggataccactgtgtaccgcaggaa
gagattaaccagatcctgctgcgggaagcgcaaaaaggcaaacgcgtggtgcggctgaaa
ggtggcgatccgtttatttttggccgtggtggcgaagagctggaaacactgtgcaacgcg
ggtattccgttctcggtggttccgggtattaccgcagcttctggttgctctgcctattcg
ggtattccactcacgcatcgcgattatgcccagagcgtacgcttaattaccggacactta
aaaaccggtggcgagctggactgggaaaacctggcggcagaaaaacagacgctggtgttc
tatatggggttgaatcaggccgcgactattcagcaaaagctgattgaacacggtatgcct
ggcgaaatgccggtggcaattgtcgaaaatggaacggcagtcacgcagcgcgtgattgac
ggtacgctcacgcaactcggtgaacttgctcagcaaatgaacagtccatcgctaattatt
attggtcgggttgttggcctgcgcgataaactgaactggttctccaaccattaa

DBGET integrated database retrieval system