KEGG   Escherichia coli 55989 (EAEC): EC55989_4227Help
Entry
EC55989_4227      CDS       T00826                                 

Gene name
rbsK
Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:eck00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EC55989_4227 (rbsK)
Enzymes [BR:eck01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     EC55989_4227 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase Aldolase Peripla_BP_3
Motif
Other DBs
NCBI-ProteinID: CAV00852
UniProt: B7L8A2
Structure
PDB: 

Jmol
Position
4317587..4318516
Genome map
AA seq 309 aa AA seqDB search
MQNAGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAF
IACTGDDSIGESVRQQLATDNIDITPVSVIKGESTGVALIFVNGEGENVIGIHAGANAAL
SPALVEAQRERIANASALLMQLESPLESVMAAAKIAHQNKTIVALNPAPARELPDELLAL
VDIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKGIRTVLITLGSRGVWASVNGEGQRV
PGFRVQAVDTIAAGDTFNGALITALLEEKPLPEAIRFAHAAAAIAVTRKGAQPSVPWREE
IDAFLDRQR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacgcaggcagcctcgttgttcttggcagcattaatgctgaccacattcttaat
cttcaatcttttcctactccaggcgaaaccgtaaccggtaaccactatcaggttgcattt
ggcggcaaaggcgcgaatcaggctgtggctgctgggcgtagcggtgcgaatatcgcgttt
attgcctgtactggcgatgacagcattggcgagagcgttcgccagcagctcgccactgat
aacatcgatattactccggtcagcgtgatcaaaggcgaatcaacaggtgtggcgctgatt
tttgttaatggcgaaggtgagaatgtcattggtattcatgccggcgctaatgctgccctt
tccccggcgctggtggaagcgcaacgtgagcgtattgccaacgcgtcagcattattaatg
cagctggaatcaccactcgaaagtgtgatggcagcggcgaaaatcgcccatcaaaataag
actatcgttgcgcttaacccggctccggctcgcgaacttcctgacgaactgctggcgctg
gtggacattattacgccaaacgaaacggaagcagaaaagctcaccggtattcgtgttgaa
aatgatgaagatgcagcgaaggcggcgcaggtactgcatgaaaaaggtatccgtactgta
ctgattactttaggaagtcgtggtgtatgggctagcgtgaatggtgaaggtcagcgcgtt
cctggattccgggtgcaggctgtcgataccattgctgccggagatacctttaacggcgcg
ttaatcacggcgttgctggaagaaaaaccattgccagaggcgattcggtttgcccatgct
gccgctgcgattgccgtaacacgtaaaggcgcacaaccttccgtaccgtggcgtgaagag
atcgacgcatttttagacaggcagaggtga

DBGET integrated database retrieval system