KEGG   Escherichia coli 55989 (EAEC): EC55989_4394Help
Entry
EC55989_4394      CDS       T00826                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase I
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck00010  Glycolysis / Gluconeogenesis
eck00030  Pentose phosphate pathway
eck00051  Fructose and mannose metabolism
eck00052  Galactose metabolism
eck00680  Methane metabolism
eck01100  Metabolic pathways
eck01110  Biosynthesis of secondary metabolites
eck01120  Microbial metabolism in diverse environments
eck01130  Biosynthesis of antibiotics
eck01200  Carbon metabolism
eck01230  Biosynthesis of amino acids
eck03018  RNA degradation
Module
eck_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eck00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EC55989_4394 (pfkA)
   00030 Pentose phosphate pathway
    EC55989_4394 (pfkA)
   00051 Fructose and mannose metabolism
    EC55989_4394 (pfkA)
   00052 Galactose metabolism
    EC55989_4394 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    EC55989_4394 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    EC55989_4394 (pfkA)
Enzymes [BR:eck01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EC55989_4394 (pfkA)
Protein phosphatases and associated proteins [BR:eck01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EC55989_4394 (pfkA)
Messenger RNA biogenesis [BR:eck03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     EC55989_4394 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: CAV01109
UniProt: B7LA13
Structure
PDB: 

Jmol
Position
4489304..4490266
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLA
AAIAGGCEFVVVPEVEFSREDLVNEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLAGYGGRCVGIQNEQLVHHDIIDA
IENMKRPFKGDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgccaggcatgaacgccgca
attcgcggggttgttcgttctgcgctgacagaaggtctggaagtaatgggcatttatgac
ggctatctgggtctgtatgaagaccgtatggtacagctagaccgttacagcgtttctgac
atgatcaaccgtggcggtacgttcctcggttctgcgcgcttcccggaattccgcgacgag
aacatccgcgccgtggctatcgaaaacctgaaaaaacgtgggatcgacgcgctggtggtt
atcggcggtgacggttcctacatgggtgcaatgcgtctgaccgaaatgggcttcccgtgc
atcggtctgccgggcactatcgacaacgacatcaaaggcactgactacactatcggtttc
ttcactgcgctgagcaccgttgtagaagcgatcgaccgtctgcgtgacacctcttcttct
caccagcgtatttccgtggtggaagtgatgggccgttattgtggcgatctgacgttggct
gcggccattgccggtggctgtgaattcgttgtggttccggaagttgaattcagccgtgaa
gacctggtaaacgaaatcaaagcgggtatcgcgaaaggtaaaaaacacgcgatcgtggcg
attaccgaacatatgtgtgatgttgacgaactggcgcatttcatcgagaaagaaaccggt
cgtgaaacccgcgcaactgtgctgggccacatccagcgcggtggttctccggtgccttac
gaccgtattctggcttcccgtatgggcgcttacgctatcgatctgctgctggcaggttac
ggcggtcgttgtgtaggtatccagaacgaacagctggttcaccacgacatcatcgacgct
atcgaaaacatgaagcgtccgttcaaaggtgactggctggactgcgcgaaaaaactgtat
taa

DBGET integrated database retrieval system