KEGG   Escherichia coli ATCC 8739: EcolC_0280Help
Entry
EcolC_0280        CDS       T00697                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:ecl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EcolC_0280
Enzymes [BR:ecl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     EcolC_0280
Exosome [BR:ecl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EcolC_0280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
318656..320842
Genome map
AA seq 728 aa AA seqDB search
MSDRIDRDVINALIAGHFADPFSVLGMHKTTAGLEVRALLPDATDVWVIEPKTGRKLAKL
ECLDSRGFFSGVIPRRKNFFRYQLAVVWHGQQNLIDDPYRFGPLIQEMDAWLLSEGTHLR
PYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRLRKESGIWELFIP
GAHNGQLYKYEMIDANGNLRLKSDPYAFEAQMRPETASLICGLPEKVVQTEERKKANQFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGSWGY
QPTGLYAPTRRFGTRDDFRYFIDAAHAAGLNVILDWVPGHFPTDDFALAEFDGTNLYEHS
DPREGYHQDWNTLIYNYGRREVSNFLVGNALYWIERFGIDALRVDAVASMIYRDYSRKEG
EWIPNEFGGRENLEAIEFLRNTNRILGEQVSGAVTMAEESTDFPGVSRPQDMGGLGFWYK
WNLGWMHDTLDYMKLDPVYRQYHHDKLTFGILYNYTENFVLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWMWAFPGKKLLFMGNEFAQGREWNHDASLDWHLLEGGDNWHHGVQ
RLVRDLNLTYRHHKAMHELDFDPYGFEWLVVDDKERSVLIFVRRDKEGNEIIVASNFTPV
PRHDYRFGINQPGKWREILNTDSMHYHGSNAGNGGTVHSDEIASHGRQHSLSLTLPPLAT
IWLVREAE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcgtatcgatagagacgtgattaacgcgctaattgcaggccattttgcggat
cctttttccgtactgggaatgcataaaaccaccgcgggactggaagtccgtgccctttta
cccgacgctaccgatgtgtgggtgattgaaccgaaaaccgggcgcaaactcgcaaaactg
gagtgtctcgactcacggggattctttagcggcgtcattccgcgacgtaagaattttttc
cgctatcagttggctgttgtctggcatggtcagcaaaacctgattgatgatccttaccgt
tttggtccgctaatccaggaaatggatgcctggctattatctgaaggtactcacctgcgc
ccgtatgaaaccttaggcgcgcatgcagatactatggatggcgtcacaggtacgcgtttc
tctgtctgggctccaaacgcccgtcgggtctcggtggttgggcaattcaactactgggac
ggtcgccgtcacccgatgcgcctgcgtaaagagagcggcatctgggaactgtttatccct
ggggcgcataacggtcagctctataaatacgagatgattgatgccaatggcaacttgcgt
ctgaagtccgacccttatgccttcgaagcgcaaatgcgcccggaaaccgcgtctcttatt
tgcgggctgccggaaaaggttgtacagactgaagagcgcaaaaaagcgaatcagtttgat
gcgccaatctctatttatgaagttcacctgggttcctggcgtcgccacaccgacaacaat
ttctggttgagctaccgcgagctggccgatcaactggtgccttatgctaaatggatgggc
tttacccacctcgaactactgcccattaacgagcatcccttcgatggcagttggggttat
cagccaaccggcctgtatgcaccaacccgccgttttggtactcgcgacgacttccgttat
ttcattgatgccgcacacgcagctggtctgaacgtgattctcgactgggtgccaggccac
ttcccgactgatgactttgcgcttgccgaatttgatggcacgaacttgtatgaacacagc
gatccgcgtgaaggctatcatcaggactggaacacgctgatctacaactatggtcgccgt
gaagtcagtaacttcctcgtcggtaacgcgctttactggattgaacgttttggtattgat
gcgctgcgcgtcgatgcggtggcgtcaatgatttatcgcgactacagccgtaaagagggg
gagtggatcccgaacgaatttggcgggcgcgagaatcttgaagcgattgaattcttgcgt
aataccaaccgtattcttggtgagcaggtttccggtgcggtgacaatggctgaggagtct
accgatttccctggcgtttctcgtccgcaggatatgggcggtctgggcttctggtacaag
tggaacctcggctggatgcatgacaccctggactacatgaagctcgacccggtttatcgt
cagtatcatcacgataaactgaccttcgggattctctacaactacactgaaaacttcgtc
ctgccgttgtcgcatgatgaagtggtccacggtaaaaaatcgattctcgaccgcatgccg
ggcgacgcatggcagaaattcgcgaacctgcgcgcctactatggctggatgtgggcattc
ccgggcaagaaactactgttcatgggtaacgaatttgcccagggccgcgagtggaaccat
gacgccagcctcgactggcatctgttggaaggcggcgataactggcaccacggtgtccag
cgtctggtgcgcgatctgaacctcacctaccgccaccataaagcaatgcatgaactggat
tttgacccgtacggctttgaatggctggtggtggatgacaaagaacgctcggtgctgatc
tttgtgcgtcgcgataaagagggtaacgaaatcatcgttgccagtaactttacgccggta
ccgcgtcatgattatcgcttcggcattaatcagccgggcaaatggcgtgaaatcctcaat
accgattccatgcactatcacggcagtaatgcaggcaatggcggcacggtacacagcgat
gagattgccagccacggtcgtcagcattcactaagcctgacgctaccaccgctggccact
atctggctggttcgggaggcagaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system