KEGG   Escherichia coli ATCC 8739: EcolC_0297Help
Entry
EcolC_0297        CDS       T00697                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EcolC_0297 (malQ)
Enzymes [BR:ecl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     EcolC_0297 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
344941..347025
Genome map
AA seq 694 aa AA seqDB search
MESKRLDNAALAAGISPNYINAHGKPQSISAETKRRLLDAMHQRTATKVAVTPVPNVMVY
TSGKKMPMVVEGSGEYSWLLTTEEGTQYKGHVTGGKAFNLPTKLPEGYHTLTLTQDDQRA
HCRVIVAPKRCYEPQALLNKQKLWGACVQLYTLRSEKNWGIGDFGDLKAMLVDVAKRGGS
FIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFHLSEEAQAWWQLPTTQQT
LQQARDADWVDYSTVTALKMTALRMAWKGFAQRDDEQMAAFRQFVADQGDSLFWQAAFDA
LHAQQVKEDEMRWGWPAWPEMYQNVDSPEVRQFCEEHRDDVDFYLWLQWLAYSQFAACWE
ISQGYEMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMDP
HIITARAYEPFIELLRANMQNCGALRIDHVMSMLRLWWIPYGETADQGAYVHYPVDDLLS
ILALESKRHRCMVIGEDLGTVPVEIVGKLRSSGVYSYKVLYFENDHEKTFRAPKAYPEQS
MAVAATHDLPTLRGYWESGDLTLGKTLGLYPDEVVLRGLYQDRELAKQGLLDALHKYGCL
PKRAGHKASLMSMTPTLNRGLQRYIADSNSALLGLQPEDWLDMAEPVNIPGTSYQYKNWR
RKLSATLETMFADDGVNKLLKDLDRRRRAAAKKK
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaacgtctggataatgccgcgctggcggcggggattagccccaattacatc
aatgcccacggtaaaccgcagtcgattagcgccgaaaccaaacggcgtttgcttgacgcg
atgcatcaacgtaccgccacgaaagtggcggtaacgccagtcccgaatgtcatggtttat
accagcggcaaaaaaatgccgatggtggtggagggcagcggcgaatatagctggctgctg
accaccgaagaaggaacacagtacaaaggccatgtaacggggggcaaagcgttcaatcta
ccgacgaagctgccggaaggttatcacacgctgacactcacccaggacgaccagcgcgcg
cattgccgggtgattgtcgccccgaagcgctgttacgaaccgcaggcgttgctgaataaa
caaaagctgtggggtgcctgcgtccagctttatacgctgcgatcggaaaaaaactggggt
attggggattttggcgatctcaaagcgatgctggtggatgtggcaaaacgtggcgggtcg
ttcatcggcctgaacccgattcatgcgctctatccggcaaatccggagagtgccagccca
tacagcccgtcttctcgccgttggctgaatgtgatttatatcgacgttaacgccgttgaa
gatttccatcttagcgaagaggctcaggcctggtggcagttgccgaccacgcaacagacg
ctgcaacaggcgcgcgatgccgactgggtcgattactccacggttaccgccctaaaaatg
acagcattacgaatggcgtggaaaggtttcgcgcaacgtgatgatgagcagatggccgcg
tttcgccagtttgttgcagatcaaggcgacagcctgttctggcaggcagcctttgatgcg
ctacatgcccagcaagtgaaagaggacgaaatgcgctggggctggcctgcatggccagag
atgtatcagaacgtggattcaccagaagtgcgtcagttctgcgaagaacatcgtgatgac
gttgatttttatctctggttgcagtggctggcttacagccagtttgccgcctgctgggag
ataagccagggctatgaaatgccgattggcttgtatcgtgatctggcggttggcgtagcg
gaaggtggggcggaaacctggtgtgaccgtgaactgtattgcctgaaagcgtcggttggc
gcgccgccggatatcctcggcccgttggggcagaactggggattaccgccaatggacccg
catattattaccgcgcgtgcctatgaaccgtttatcgagctgttgcgtgccaatatgcaa
aactgcggcgcattacgaattgaccatgtgatgtcgatgctgcgtttgtggtggataccg
tatggcgagacggcagatcagggcgcgtatgttcactatccggtggatgatctgctttcg
attctggcactcgaaagtaaacgtcatcgctgtatggtgattggtgaagatctcggtacc
gtaccggtagagattgtcggtaagctgcgcagcagcggtgtgtactcctacaaagtgctc
tatttcgaaaacgaccacgagaagacgttccgtgcaccgaaagcgtatccggagcagtcg
atggcggttgcggcgacacatgacctgcctacgctacgcggctactgggagagcggggat
ctaacgctgggcaaaaccctggggctgtatccggatgaagtggtactgcgcggtctgtat
caggatcgcgaactggcgaagcaagggctgctggatgcactgcataaatatggttgtctg
ccaaaacgtgccgggcataaggcatcgttgatgtcgatgacgccgacgcttaatcgtggt
ttgcagcgctacattgccgacagtaacagtgctctgttaggactacagccggaagactgg
ctggatatggccgaaccggtgaatattcctggcaccagttaccagtataaaaactggcgg
cgcaagctctccgcaacgcttgagacgatgtttgccgatgatggcgtgaacaagttgctg
aaggatttggacagacggcgcagagctgcagcgaagaagaagtag

DBGET integrated database retrieval system