KEGG   Escherichia coli ATCC 8739: EcolC_0375Help
Entry
EcolC_0375        CDS       T00697                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K13381  
bifunctional chitinase/lysozyme [EC:3.2.1.14 3.2.1.17]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EcolC_0375
Enzymes [BR:ecl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     EcolC_0375
    3.2.1.17  lysozyme
     EcolC_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
425077..427770
Genome map
AA seq 897 aa AA seqDB search
MKLNIFTKSMIGMGLVCSALPALAMEAWNNQQGGNKYQVIFDGKIYENAWWVSSTNCPGK
AKANDATNPWRLKRTATAAEISQFGNTLSCEKSGSSSSSNSNTPASNTPANGGSATPAQG
TVPSNSSVVAWNKQQGGQTWYVVFNGAVYKNAWWVASSNCPGDAKGNDASNPWRYVRAAT
ATEISETSNPQSCTSAPQPAPDVKPAPDVKPAPDVQPAPADKSNDNYAVVAWKGQEGSST
WYVIYNGGIYKNAWWVGAANCPGDAKENDASNPWRYVRAATATEISQYGNPGSCSVKPDN
NGGAVTPVDPTPETPVTPTPDNSEPSTPADSGNDYSLQAWSGQEGSEIYHVIFNGNVYKN
AWWVGSKDCPRGTSAENSNNPWRLERTATAAELSQYGNPTTCEIDNGGVIVADGFQASKA
YSANSIVDYNDAHYKTSVDQDAWGFVPGGDNPWKKYEPAKAWSASTVYVKGDRVVVDGQA
YEALFWTQSDNPALVANQNATGSNSRPWKPLGKAQSYSNEELNNAPQFNPETLYASDTLI
RFNGVNYISQSKVQKVSPSDSNPWRVFVDWTGTKERVGTPKKAWPKHVYAPYVDFTLNTI
PDLAALAKNHNVNHFTLAFVVSKDANTCLPTWGTAYGMQNYAQYSKIKALRKAGGDVMLS
IGGANNAPLAASCKNVDDLMQHYYDIVDNLNLRVLDFDIEGTWVADQASIERRNLAVKKV
QDKWKSEGKDIAIWYTLPILPTGLTPEGMNVLSDAKAKGVELAGVNVMTMDYGNAICQSA
NTEGQNIHGKCATSAIANLHSQLKGLHPNKSDAEIDAMMGTTPMVGVNDVQGEVFYLSDA
RLVMQDAQKRNLGMVGIWSIARDLPGGTNLSPEFHGLTKEQAPKYAFSEIFAPFTKQ
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaatatatttactaaatctatgattggtatggggctggtgtgttccgctctg
ccagcattggcaatggaagcatggaataaccaacaaggtggtaataaatatcaggttatt
ttcgatggcaaaatttatgaaaatgcctggtgggtttcttctacaaattgcccgggaaaa
gcgaaagcaaatgatgcaactaacccgtggcgtttaaagcgtaccgcaacagctgctgaa
attagtcagtttggcaatacactttcctgcgaaaagagcggcagctcatcttcttcaaat
tcaaatacgcctgcatccaatacgccggctaatggcggttcggctacaccagcacagggc
actgttccgtctaattcttctgtagttgcctggaataaacagcagggcggtcagacctgg
tatgtcgtctttaatggtgcggtatataaaaatgcctggtgggtagcctcttctaactgt
ccgggtgatgcgaaaggcaatgatgccagcaacccatggcgttatgttcgtgccgctacg
gcaacggaaatctcagaaaccagtaatccacagtcctgtacttcagcaccacagcctgca
ccggatgtgaaaccggcaccggacgttaaaccggctcctgatgttcagccagccccagct
gataagtcaaacgacaactatgctgtagtagcctggaaaggtcaggaaggttcttctaca
tggtacgttatctataacggcggcatttataagaacgcctggtgggtaggcgcggcaaat
tgcccaggcgatgcgaaagaaaacgatgccagtaacccatggcgttatgttcgcgcggca
acggcaacagaaatcagccagtatggtaaccctggctcctgttccgttaagccggataat
aatggcggtgctgtgactccggttgatccaactccggaaacaccggtgaccccaactccg
gataacagcgagccatcaacaccagcggatagcggtaacgattactcattgcaagcgtgg
agcggccaggaaggtagcgaaatttaccatgttattttcaatggtaatgtttacaagaac
gcctggtgggttgggtctaaagattgcccacggggtaccagcgctgaaaactccaataac
ccatggcgtctcgagcgtacagctaccgctgcggaattgagtcagtacggtaacccgact
acctgtgaaattgataacggcggcgtcattgttgcggatggtttccaggccagcaaagcg
tacagcgcgaacagcatcgtagattataacgatgcacattataaaacttctgtcgatcaa
gacgcatggggctttgtcccgggcggcgataacccgtggaagaaatacgaaccggcgaaa
gcatggtccgcatccactgtgtacgtgaaaggtgatcgcgttgttgttgatgggcaggct
tatgaagcgctgttctggacgcaaagtgacaaccctgctctggttgcgaaccaaaacgcc
accggtagcaatagccgcccgtggaagccgttaggtaaggctcagagctatagcaacgaa
gagctgaataatgcgccgcagtttaatccagaaacgctttatgccagcgatacgctgatt
cgctttaacggtgtgaactacatttctcagagtaaagtgcagaaagtttctccttctgac
agcaacccgtggcgtgtttttgttgactggaccggaaccaaagaacgtgtaggtacgccg
aagaaagcatggccgaaacacgtttatgcaccgtatgttgactttacgctgaatacgatc
ccggatttggctgcgctggctaagaatcataacgtcaaccacttcacgctggcgtttgtg
gtgagtaaagatgcgaacacctgtctgccgacatggggtaccgcttatggtatgcagaat
tacgctcagtacagcaaaatcaaagctctgcgtaaggctggcggcgatgtgatgctgtct
atcggtggtgctaacaacgctccgctggctgcttcctgtaagaacgtagacgatctgatg
cagcattattatgacatcgttgataacctgaacctcagagtcctggacttcgatatcgaa
ggcacctgggttgcggatcaggcatctattgaacgtcgtaaccttgctgtgaagaaagtg
caggataaatggaagtcagaaggcaaagatattgctatctggtacaccttgccaattcta
ccgactggcctgacgccggaagggatgaatgtcctgagcgatgccaaagcgaaaggtgtt
gagctggcgggtgtgaacgtgatgacaatggactacggtaacgcgatttgtcagtctgca
aataccgaaggccagaacattcacggtaagtgtgcaacgtctgcgattgccaacctgcat
tcacaattgaaaggcctccatcccaacaagagcgatgcagaaattgacgctatgatgggt
accacgccgatggttggcgtgaacgacgttcagggcgaggtgttctatctctctgatgct
cgtctggtcatgcaggatgcgcagaagcgtaatctcggtatggttggtatctggtcaatc
gcgcgcgacctgccgggcggcactaacctgtctccggaattccacggcctgactaaagaa
caggcaccgaagtacgcatttagcgaaatcttcgcgccgtttactaagcaataa

DBGET integrated database retrieval system