KEGG   Escherichia coli ATCC 8739: EcolC_0808Help
Entry
EcolC_0808        CDS       T00697                                 

Definition
glycoside hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ecl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcolC_0808
Enzymes [BR:ecl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EcolC_0808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(867643..869076)
Genome map
AA seq 477 aa AA seqDB search
MKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVLPGKYYP
NHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMFDELL
KYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEIN
NQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINPEMKVGCML
AMVPLYPYSCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGDLD
VLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRYAL
CELYERYQRPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLMGY
TPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGEKL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaactcaccttaccgaaagatttcttatggggcggcgcagttgccgctcatcag
gtcgaaggcggctggaacaaaggcggaaaagggccgagcatttgtgacgttctgaccggt
ggcgcacacggcgtgccgcgcgaaatcaccaaagaagtcttgccaggaaaatactatcca
aaccatgaagccgttgatttttatggtcactataaggaagacatcaagctatttgccgaa
atgggcttcaaatgttttcgtacatccattgcctggacgcgcatttttccaaaaggcgat
gaagctcagccaaacgaagaagggctgaagttctacgatgatatgttcgatgaactgctg
aaatacaacatcgaaccggtgatcaccctctcccactttgaaatgccgctgcatctggtg
cagcaatacggtagctggaccaaccgtaaagtggttgatttctttgtacgtttcgcggaa
gtggtatttgaacgctataagcacaaagtcaaatactggatgaccttcaacgaaattaac
aaccagcgtaactggcgtgcaccgctgttcggttactgctgctccggcgtggtgtatacc
gagcatgaaaacccggaagagacgatgtatcaggtgctgcatcaccagtttgtcgccagc
gccctggcggtgaaagctgcgcgtcgcattaacccggagatgaaagtcggctgtatgctg
gcgatggtgccgctctatccttactcctgtaacccggacgatgtgatgttcgctcaggag
tcgatgcgcgaacgctacgtctttaccgatgtgcagctacgcggctattacccgtcctat
gtgttgaacgagtgggagcgtcgcggatttaacatcaaaatggaagacggcgatctggat
gtgctgcgtgaaggcacctgcgattatcttggtttcagctattacatgaccaatgcagtg
aaggccgaaggcggcaccggcgatgcgatctctggttttgaaggcagcgtaccaaacccg
tatgttaaagcatctgactggggctggcagattgatccagtaggtctgcgctatgcactt
tgcgaactgtatgagcgttatcagaggccgctgtttattgtcgaaaacggttttggcgct
tacgacaaagtggaagaagatggcagcatcaacgacgactaccgcattgactacctgcgc
gcccatatcgaagagatgaaaaaagcggtgacttacgatggcgtggatctgatgggctac
acaccgtggggctgcatcgactgcgtgtcgttcaccaccgggcagtacagcaaacgctac
ggctttatctatgtgaataaacatgacgacggtactggcgatatgtcgcgttcacgtaag
aagagctttaactggtacaaagaggtgattgccagcaacggcgagaagctttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system