KEGG   Escherichia coli C ATCC 8739: EcolC_1495Help
Entry
EcolC_1495        CDS       T00697                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ecl  Escherichia coli C ATCC 8739
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ecl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
1651472..1652140
Genome map
AA seq 222 aa AA seqDB search
MPSLSKEAALVHEALVARGLETPLRPPVHEMDNETRKSLIAGHMTEIMQLLNLDLADDSL
METPHRIAKMYVDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILIALQTLLGTNNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRHEFLRAVRHHN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgccatcactcagtaaagaagcggccctggttcatgaagcgttagttgcgcgaggactg
gaaacaccgctgcgcccgcccgtgcatgaaatggataacgaaacgcgcaaaagccttatt
gctggtcatatgaccgaaatcatgcagctgctgaatctcgacctggctgatgacagtttg
atggaaacgccgcatcgcatcgctaaaatgtatgtcgatgaaattttctccggtctggat
tacgccaacttcccgaaaatcaccctcattgaaaacaaaatgaaggtcgatgaaatggtc
accgtgcgcgatatcactctgaccagtacctgtgaacaccattttgttaccatcgatggc
aaagcgacggtggcttatatcccgaaagattcggtgatcggtctgtcaaaaattaaccgt
atcgtgcagttctttgcccagcgtccgcaggtgcaggaacgtctgacgcagcaaattctt
attgcgctacaaacgctgctgggcaccaataacgtggctgtctcgatcgacgcggtgcat
tactgcgtgaaggcgcgtggcatccgcgatgcaaccagtgccacgacaacgacctctctt
ggtggattgttcaaatccagtcagaatacgcgccacgagtttctgcgcgctgtgcgtcat
cacaactga

DBGET integrated database retrieval system