KEGG   Escherichia coli ATCC 8739: EcolC_1600Help
Entry
EcolC_1600        CDS       T00697                                 

Definition
(GenBank) regulatory protein GalF
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl00040  Pentose and glucuronate interconversions
ecl00052  Galactose metabolism
ecl00500  Starch and sucrose metabolism
ecl00520  Amino sugar and nucleotide sugar metabolism
ecl01100  Metabolic pathways
ecl01130  Biosynthesis of antibiotics
Module
ecl_M00362  Nucleotide sugar biosynthesis, prokaryotes
ecl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ecl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EcolC_1600
   00052 Galactose metabolism
    EcolC_1600
   00500 Starch and sucrose metabolism
    EcolC_1600
   00520 Amino sugar and nucleotide sugar metabolism
    EcolC_1600
Enzymes [BR:ecl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EcolC_1600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 EFP_N
Motif
Other DBs
NCBI-ProteinID: ACA77259
JGI: EcolC1600
Position
1780323..1781216
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGESYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttataccggtagcaggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcgtccaag
aatgcggtcgaaaaccacttcgacacctcttatgaattagaatctctccttgaacagcgc
gtgaagcgtcaactgctggcggaagtgcagtctatctgtccgcctggcgtgaccattatg
aacgtgcgtcagggcgaacctttaggtttaggccactccattttatgtgcacgacccgcc
attggcgacaacccatttgtcgtggtactgccagacgtagtgatcgacgacgccagcgcc
gacccgctgcgctacaaccttgctgccatgattgcgcgcttcaatgaaacgggccgtagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactccgtcattcagaccaaa
gaaccgctggaccgtgaaggcaaagtcagccgcattgttgaattcatcgaaaaaccggat
cagccacagacgctggactcagacatcatggccgttggtcgctatgtgctttctgccgat
atttggccggaacttgaacgcactcaacctggtgcatgggggcgtattcagctgactgat
gccattgctgaactggcgaaaaaacagtccgttgatgcaatgctgatgactggtgaaagc
tacgactgcggtaaaaaaatgggttatatgcaggcgttcgtgaagtatggactacgcaac
ctgaaagaaggggcgaagttccgtaaagggattgagaagctgttaagcgaataa

DBGET integrated database retrieval system