KEGG   Escherichia coli ATCC 8739: EcolC_1604Help
Entry
EcolC_1604        CDS       T00697                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    EcolC_1604
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EcolC_1604
Enzymes [BR:ecl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     EcolC_1604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1784513..1785046
Genome map
AA seq 177 aa AA seqDB search
MNVIKTEIPEVLIFEPKKFEDSRGYFFESFNQRLFEDAVGKEILFVQDNQSYSSKNVLRG
LHYQSEPYAQGKLVRCIMGEVFDVAVDIRKESESYGQWVGVFLSEDNNRQLWIPEGFAHG
FLVKSDKAIFAYKCTNFYNPSAENTIRWDSPDLAIEWPLDDEDLLISEKDLLGRKFL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaattaaaacagaaattccagaagtcttgatttttgagcctaaaaaatttgag
gactccagggggtatttttttgaaagctttaatcaaaggctttttgaagatgccgtagga
aaagaaattctatttgtccaagataatcaatcatattcaagtaaaaatgtattaagaggt
ttacattatcaaagcgagccgtatgctcaagggaagctagtaagatgtattatgggggaa
gtatttgatgtagccgtagatattagaaaagagtcagaaagttatgggcaatgggttgga
gtatttttatctgaggataataatagacagttatggatacctgaaggatttgctcacggt
tttcttgttaaaagcgataaagcaatttttgcatataaatgtactaatttttataaccct
tctgctgaaaatactattagatgggactcgcctgatttggcaattgaatggcctttagat
gatgaagatttattgatatcggaaaaagatttattaggaagaaaatttttataa

DBGET integrated database retrieval system