KEGG   Escherichia coli ATCC 8739: EcolC_1909Help
Entry
EcolC_1909        CDS       T00697                                 

Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ecl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EcolC_1909
   01230 Biosynthesis of amino acids
    EcolC_1909
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcolC_1909
   00030 Pentose phosphate pathway
    EcolC_1909
   00051 Fructose and mannose metabolism
    EcolC_1909
   00052 Galactose metabolism
    EcolC_1909
  Energy metabolism
   00680 Methane metabolism
    EcolC_1909
Enzymes [BR:ecl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EcolC_1909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2109390..2110319)
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFP
AGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQ
LEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIIDSSGEALSAALAIGN
IELVKPNQKELSTLVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDT
QKIYAYLSR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacacttgcgccctctctcgatagcgcaacaattaccccg
caaatttatcccgaaggaaaactgcgctgtaccgcaccggtgttcgaacccgggggcggc
ggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttcccg
gcgggtggcgcgaccggcgaacacctggtttcactgttggcggatgaaaatgtccccgtt
gctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagcaagc
ggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgccag
cttgaagagcaagttctggaaattgaatccggggccatcctggtcataagcggaagcctg
ccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaacaaggg
atccgctgcatcatcgacagttctggcgaagcgttaagtgcagcactggcgattggtaac
atcgagttggttaagcctaaccaaaaagaactcagtacgctggtgaatcgcgaactcacc
cagccagacgatgtccgcaaagccgcgcaggaaatcgttaatagcggcaaggccaaacgg
gttgtcgtttcccttggtccacaaggagcgctgggtgttgatagtgaaaactgcattcag
gtggtgccaccaccggtgaaaagccagagtaccgttggcgctggtgacagcatggtcggc
gcgatgacactgaaactggcagaaaatgcctctcttgaagagatggttcgttttggcgta
gctgcggggagtgcagccacactcaatcagggtacacgtctgtgctcccatgacgatacg
caaaaaatttacgcttacctttcccgctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system