KEGG   Escherichia coli ATCC 8739: EcolC_2134Help
Entry
EcolC_2134        CDS       T00697                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EcolC_2134
   00330 Arginine and proline metabolism
    EcolC_2134
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    EcolC_2134
Enzymes [BR:ecl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     EcolC_2134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2330617..2331543
Genome map
AA seq 308 aa AA seqDB search
MAVAMDNAILENILRQVRPLIGQGKVADYIPALATVDGSRLGIAICTVDGQLFQAGDAQE
RFSIQSISKVLSLVVAMRHYSEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGA
LVVCDMLQGRLSAPRQRMLEVVRGLSGVSDISYDTVVARSEFEHSARNAAIAWLMKSFGN
FHHDVTTVLQNYFHYCALKMSCVELARTFVFLANQGKAIHIDEPVVTPMQARQINALMAT
SGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDDAGNSLAGIAVLEQLT
KQLGRSVY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtcgccatggataatgcaattttagaaaacatcttgcggcaagtgcggccgctc
attggtcagggtaaagtcgcggattatattccggcgctggctacagtagacggttcccga
ttggggattgctatctgtaccgttgacggacagctttttcaggccggagacgcgcaagaa
cgtttttccattcagtctatttccaaagtgctgagtctcgttgtcgccatgcgtcattac
tccgaagaggaaatctggcaacgcgtcggcaaagatccgtctggatcaccgttcaattcc
ttagtgcaactggaaatggagcagggtataccgcgtaatccgttcattaatgccggtgcg
ctggtggtctgcgatatgttgcaagggcgattaagcgcaccacggcaacgtatgctggaa
gtcgtgcgcggcttaagcggtgtgtctgatatttcctacgatacggtggtagcgcgttcc
gaatttgaacattccgcgcgaaatgcggctatcgcctggctgatgaagtcgtttggcaat
ttccatcatgacgtgacaaccgttctgcaaaactactttcattactgcgctctgaaaatg
agctgtgtagagctggcccggacgtttgtctttctggctaatcaggggaaagctattcat
attgatgaaccagtggtgacgccaatgcaggcgcggcaaattaacgcgctgatggcgacc
agtggtatgtaccagaacgcgggggagtttgcctggcgggtgggactaccggcgaaatct
ggcgttgggggcggtattgtggcgattgttccgcatgaaatggccatcgcagtctggagt
ccggaactggatgatgcaggtaactcgcttgcgggtatcgccgttcttgaacaattaacg
aaacagttagggcgttcggtttattaa

DBGET integrated database retrieval system