KEGG   Escherichia coli ATCC 8739: EcolC_2770Help
Entry
EcolC_2770        CDS       T00697                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ecl  Escherichia coli ATCC 8739
Brite
Enzymes [BR:ecl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     EcolC_2770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3039666..3040181)
Genome map
AA seq 171 aa AA seqDB search
MNPSIIKRCLVGAVLAIAATLPGFQQLHTSVEGLKLIADYEGCRLQPYQCSAGVWTDGIG
NTSGVIPGKTITERQAAEGLISNVLRVERALERCVKQQPPQKVYDATVSFAFNVGTGNAC
SSTLVKLLNQRRWADACRQLPRWVYVKGVFNQGLDNRRAREMAWCLKGAGL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatcaatcattaaacgctgccttgtcggggccgtgctggctattgctgccacg
ttgccgggttttcagcagcttcacacctccgtggaggggctgaaactgattgccgattac
gaaggctgtcgtctgcagccgtatcagtgcagcgcgggtgtctggaccgatggcattggt
aatacatcgggcgtcattcccggcaaaaccatcacggaacgacaggcagcggaagggctg
atctccaacgtgctgcgtgtggagcgggcgttggaaaggtgtgtgaagcaacagccgccg
cagaaggtgtatgacgctacggtgtcgtttgccttcaacgtggggacgggcaatgcctgt
agttccacgctggtgaaattgctcaatcagcggcgctgggcggatgcgtgccgacagttg
ccgcgctgggtttatgtgaaaggtgtttttaatcaggggctggataaccgccgtgcgcgg
gagatggcctggtgccttaaaggagctggactatga

DBGET integrated database retrieval system