KEGG   Escherichia coli ATCC 8739: EcolC_2907Help
Entry
EcolC_2907        CDS       T00697                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl00010  Glycolysis / Gluconeogenesis
ecl00260  Glycine, serine and threonine metabolism
ecl00680  Methane metabolism
ecl01100  Metabolic pathways
ecl01110  Biosynthesis of secondary metabolites
ecl01120  Microbial metabolism in diverse environments
ecl01130  Biosynthesis of antibiotics
ecl01200  Carbon metabolism
ecl01230  Biosynthesis of amino acids
Module
ecl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecl_M00002  Glycolysis, core module involving three-carbon compounds
ecl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcolC_2907
  Energy metabolism
   00680 Methane metabolism
    EcolC_2907
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EcolC_2907
Enzymes [BR:ecl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EcolC_2907
Membrane trafficking [BR:ecl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    EcolC_2907
Exosome [BR:ecl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EcolC_2907
  Exosomal proteins of melanoma cells
   EcolC_2907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: ACA78534
JGI: EcolC2907
UniProt: B1IXY1
Structure
PDB: 

Jmol
Position
3167972..3168724
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacttctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcggaaactgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtgactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactgagcgagaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaactattctgccgcgtatgaagagcggtgagcgcgtgatc
atcgctgcacacggtaactctttacgtgcgctggtgaaatatcttgataacatgagcgaa
gaagagattcttgagcttaatatcccgactggcgtgccgctggtgtatgagttcgacgag
aatttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcagcgaaagca
gcggcggttgcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system