KEGG   Escherichia coli ATCC 8739: EcolC_2933Help
Entry
EcolC_2933        CDS       T00697                                 

Gene name
sdhD
Definition
succinate dehydrogenase cytochrome b556 small membrane subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ecl  Escherichia coli ATCC 8739
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ecl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EcolC_2933 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EcolC_2933 (sdhD)
   00650 Butanoate metabolism
    EcolC_2933 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    EcolC_2933 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3199313..3199660)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgctaccagt
ggcgagctgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgatccatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggctttgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system