KEGG   Escherichia coli C ATCC 8739: EcolC_2994Help
Entry
EcolC_2994        CDS       T00697                                 

Gene name
rihA
Definition
ribonucleoside hydrolase 1 (EC:3.2.2.1)
Orthology
K01250  
pyrimidine-specific ribonucleoside hydrolase [EC:3.2.-.-]
Organism
ecl  Escherichia coli C ATCC 8739
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3272821..3273756
Genome map
AA seq 311 aa AA seqDB search
MALPILLDCDPGHDDAIAIVLALASPELDVKAITSSAGNQTPEKTLRNVLRMLTLLNRTD
IPVAGGAVKPLMRELIIADNVHGESGLDGPALPEPAFAPQNCTAVELMAKTLRESAEPVT
IVSTGPQTNVALLLNSHPELHSKIARIVIMGGAMGLGNWTPAAEFNIYVDPEAAEIVFQS
GIPVVMAGLDVTHKAQIHVEDTERFRAIGNPVSTIVAELLDFFLEYHKDEKWGFVGAPLH
DPCTIAWLLKPELFTSVERWVGVETQGKYTQGMTVVDYYYLTGNKPNATVMVDVDRQGFV
DLLADRLKFYA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcactgccaattctgttagattgcgacccaggtcatgacgacgctatcgcaatagtt
ctcgccctcgcctcaccagagcttgatgtcaaagcaattacgtcttccgccggaaaccag
acaccagaaaaaaccttacgcaatgttcttcgtatgctgaccttgctcaatcgcaccgat
attccggtagcaggcggcgcggtaaaaccgttaatgcgtgagttgattatcgcggacaat
gtgcacggcgaaagcggtctcgacggcccggcattaccggaaccggcgttcgcaccgcaa
aactgtacggcggtagagctaatggcgaaaacgctgcgtgaaagtgcggaacctgtcacc
attgtgtctaccggaccgcaaactaacgttgccttgctgctcaatagccatccggaactg
catagcaaaattgcccgtatcgtgattatgggcggcgcaatggggcttggtaactggacg
ccagcggctgaatttaatatttacgttgacccggaagcggcagaaattgtcttccagtca
gggatcccggtggtgatggccggtctggatgttactcataaagcacaaatccacgttgaa
gacaccgagcgtttccgcgcgattggtaaccctgtttcaaccattgttgccgaactgctg
gatttcttcctcgaatatcataaagacgaaaaatggggctttgtcggcgcaccactgcat
gacccatgcaccatcgcctggctgttgaaaccggagttatttacctctgttgagcgctgg
gttggcgtggaaacacaggggaaatatacccagggtatgacggttgttgattattattat
ctgacaggcaataaaccgaatgccaccgtaatggtcgatgttgatcgtcagggctttgtt
gatttactggctgatcgtctgaaattttacgcttaa

DBGET integrated database retrieval system