KEGG   Escherichia coli C ATCC 8739: EcolC_3122Help
Entry
EcolC_3122        CDS       T00697                                 

Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1 (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ecl  Escherichia coli C ATCC 8739
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ecl01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
3421222..3421815
Genome map
AA seq 197 aa AA seqDB search
MPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSASAAWPALLNDKWQSKTSVVNASISGD
TSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQDVKAANAEPLLM
QIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDDGIHPNRDAQPF
IADWMAKQLQPLVNHDS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ttgcccttcctgttcctggtcctgttaaccttccgtgccgccgcagcggacacgttattg
attctgggtgatagcctgagcgccgggtatcgaatgtctgccagcgcggcctggcctgcc
ttgttgaatgataagtggcagagtaaaacgtcggtagttaatgccagcatcagcggcgac
acctcgcaacaaggactggcgcgccttccggctctgctgaaacagcatcagccgcgttgg
gtgctggttgaactgggcggcaatgacggtttgcgtggttttcagccacagcaaaccgag
caaacgctgcgccagattttgcaggatgtcaaagccgccaacgctgaaccattgttaatg
caaatacgtctgcctgcaaactatggtcgccgttataatgaagcctttagcgccatttac
cccaaactcgccaaagagtttgatgttccgctgctgcccttttttatggaagaggtctac
ctcaagccacaatggatgcaggatgacggtattcatcccaaccgcgacgcccagccgttt
attgccgactggatggcgaagcagttgcagcctttagtaaatcatgactcataa

DBGET integrated database retrieval system