KEGG   Escherichia coli C ATCC 8739: EcolC_3144Help
Entry
EcolC_3144        CDS       T00697                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ecl  Escherichia coli C ATCC 8739
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ecl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3446550..3447155)
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIRF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccgctgttaacacagcttatggaagcactgcgctgtctgccgggcgtt
ggcccgaagtcggcgcagcgtatggcgttcacgctgcttcagcgcgatcgtagcggcggg
atgcgtctggcgcaggcgctcacccgggcgatgtcggaaatcggccactgcgccgattgc
cgcactttcaccgaacaggaagtctgtaacatctgttcgaatccgcgtcgtcaggaaaac
ggtcaaatctgcgtggtggagagtccggcggacatctacgccattgagcagacggggcag
ttttcaggtcgttattttgtgttgatggggcatctgtcaccgctggacggcatcggtccg
gatgatatcgggcttgatcgtctggaacagcgtctggcagaggaaaaaatcactgaagtg
atcctcgccaccaaccccacggttgaaggtgaagctaccgctaactacattgccgagctt
tgcgcgcaatatgacgtggaagccagccgaatcgctcatggcgttccggttggcggcgag
ctggaaatggtcgacggcaccacgttgtcacactcccttgccgggcgtcataagattcgt
ttttaa

DBGET integrated database retrieval system